KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16E9.10c
Entry
SPBC16E9.10c      CDS       T00076                                 

Definition
(RefSeq) putative AAA family ATPase Rix7
  KO
K14571  ribosome biogenesis ATPase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SPBC16E9.10c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC16E9.10c
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    SPBC16E9.10c
SSDB
Motif
Pfam: AAA AAA_lid_3 RuvB_N AAA_16 AAA_22 AAA_5 AAA_2 AAA_33 TIP49 AAA_14 AAA_18 RNA_helicase AAA_28 Mg_chelatase AAA_3 Vps4_C NACHT Cytidylate_kin2 AAA_17 Zeta_toxin AAA_25 IstB_IS21 Rad17 ABC_tran TsaE AAA_7 NB-ARC ATPase DUF815 Sigma54_activat Viral_helicase1 SKI Sigma54_activ_2 AAA_24 Parvo_NS1 DUF5906 AAA_11 Neuregulin CPT
Other DBs
NCBI-GeneID: 2539968
NCBI-ProteinID: NP_595792
PomBase: SPBC16E9.10c
UniProt: O14325
Position
II:complement(join(1931899..1933328,1933372..1933800,1933860..1934025,1934087..1934401))
AA seq 779 aa
MRRSGTSLSRDLERKIHERLVSLKDTIQQTEIEEWPVSTRRAIQFVQERDMSLRRIKKPI
LEKVVEKVLDTLKAEVEEKLASSQDLVLVDSDMEEQSDSNLMEVKDTNVINKSITSLWSS
PNLKEIDGEDEKKSVGQESITGSAKRKDRRSKTNGSKRQKAEANREPPSDISLSDIGGLD
DCINELLELVAMPIKHPEVYQYTGIHPPRGVLLHGPPGCGKTMLANALANELGVPFISIS
APSIVSGMSGESEKKVREVFEEAKSLAPCLMFIDEIDAVTPKRESAQREMERRIVAQFLT
CMDELSFEKTDGKPVLVIGATNRPDSLDSALRRAGRFDREICLTVPSQDAREKILRTMAK
GLKLSGDFDFRQLAKQTPGYVGADLKALTAAAGIIAIKRIFNEISPLNKLDLNSDPRFNE
LDSDMALDSNDSLPLDHSSIIQRYLNAHPDPLSPEELEPLAICPQDFIEALAKVQPSSKR
EGFATVPGVSWNNIGALKSIRVELQMAIVQPIKRPELYQSVGISAPTGVLLWGPPGCGKT
LLAKAVANESKANFISIRGPELLNKYVGESERAVRQVFLRARASSPCVIFFDELDAMVPR
RDDSLSEASSRVVNTLLTELDGLSDRSGVYVIAATNRPDIIDPAMLRPGRLDKTLLVDLP
DAHERVEILKTLTKQTPLHEEVNLDVLGRDERCSNFSGADLAALVREAAVTALRSAVFAD
IASNEPEITQHSALEPIRVTNADFELAFKNIKPSVSDRDRQKYQRLAKRWSSASTNDAD
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgagaaggtctggtacatcgcttagtcgtgatttggagcggaaaattcatgaacgtttg
gtttctttgaaagataccattcaacaaacagaaattgaagagtggccagtttctactcgt
cgggctattcaatttgttcaagaaagggacatgtctcttcgaagaattaagaagccaatc
cttgaaaaagttgtcgaaaaagttttagacacattgaaggccgaagtggaggaaaaatta
gcttcctctcaggatttagtacttgttgatagcgacatggaagaacaatctgactcaaac
ttgatggaagttaaggataccaatgtgattaacaaaagcatcactagtctttggagctct
ccaaacttgaaagaaatagatggagaagatgagaaaaagtctgttggtcaggaatcgatt
actggatctgccaaaagaaaagatcgtcgatccaagactaatggttcaaagcgtcaaaaa
gcggaagcgaatagagaaccaccaagtgacatttctttgagtgatataggaggactagat
gattgtattaacgaattgcttgagctagtcgcaatgccgatcaagcatcctgaagtatac
caatatactggaattcatcctcccaggggtgtactgttacatggtcctcccggttgtggt
aaaactatgttagccaacgcattagccaacgaattgggtgttcccttcatctctatatct
gctccctctattgtttctgggatgtccggcgaatctgaaaaaaaagttagggaggtcttt
gaagaggctaaatcgttagccccctgtttgatgtttatagatgaaattgatgccgttact
cccaaacgtgaaagtgctcaaagagaaatggaacgtaggattgtcgctcaattccttaca
tgcatggacgaactttcttttgagaaaactgatggcaaacctgtcttggtaattggtgct
actaatagacctgattcgttagatagtgcattacgccgtgcaggaagatttgacagagaa
atatgcttgaccgtcccaagtcaagacgctcgcgagaaaattttacgtactatggcaaag
ggtttgaaacttagtggagattttgacttccgtcaattagcgaagcagacgcctggttat
gtgggtgccgacctaaaagcactcactgctgctgccggcattatagcaataaaaaggatt
ttcaatgaaatttctccgctgaacaaattggaccttaattctgatcccagatttaatgaa
cttgacagtgatatggccttagattcaaacgacagcttaccccttgatcattcttctata
attcaaagatatttgaatgctcatcctgatccactatctccagaggaacttgaaccactc
gctatttgtccacaagattttattgaagcactcgccaaagttcaaccttcgtctaaacgt
gaaggatttgctaccgttccaggtgtttcttggaataatattggtgcactaaaatcaatt
cgtgtcgaattacaaatggccatcgttcagcccatcaaacgtccggagctttaccaaagc
gttggtatcagtgcacctacaggcgttttactatggggtcctcctggatgtggtaaaact
ctgttggctaaagcggttgcaaatgaaagtaaagcaaattttatatccattcgtggtcca
gaattgcttaataagtatgttggtgagtcagaacgtgcagtgcgacaagttttcctcaga
gcacgtgcatcttctccatgtgttatcttttttgatgaattagatgcgatggtacccagg
cgtgatgactcactgtcagaagcctcgtcaagagttgtaaatacccttcttactgaactg
gacggtcttagcgatcgttcaggagtttatgtaattgctgctaccaatcgaccggatatt
atagatccagcaatgctgcgtcctggtcgtttagataaaacattgcttgttgatttaccg
gatgctcatgaacgggtggagattttaaaaacgttgacaaaacagacgcccttacacgaa
gaggtaaatttggatgtacttggtcgagatgaaagatgcagtaatttttcgggtgcagat
ttggctgcccttgtgcgtgaagcagctgtgacagctctgcgatcagccgtttttgcagat
attgcttcaaatgaaccagaaattacacaacattcagcattagagccaattcgtgtgaca
aatgctgactttgagttagcattcaagaatatcaagccaagtgtctccgatcgcgatcga
caaaagtaccaacgactggcaaagcgttggtcttcggcaagtacaaatgatgctgactag

DBGET integrated database retrieval system