KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16G5.15c
Entry
SPBC16G5.15c      CDS       T00076                                 

Gene name
fkh2
Definition
(RefSeq) fork head transcription factor Fkh2
  KO
K24664  forkhead protein FKH
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spo03000]
    SPBC16G5.15c (fkh2)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC16G5.15c (fkh2)
Transcription factors [BR:spo03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    SPBC16G5.15c (fkh2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    SPBC16G5.15c (fkh2)
SSDB
Motif
Pfam: Forkhead FHA
Other DBs
NCBI-GeneID: 2539703
NCBI-ProteinID: NP_596764
PomBase: SPBC16G5.15c
UniProt: O60129
Position
II:complement(join(4240442..4241858,4242151..4242662))
AA seq 642 aa
MTVRRLESKSEHISDDEERKEQLDYKKQMDVDTDRNIVLNGRLESQIAKLSVPPHEMRVV
DDYSNSKNAERHSGEIQAYAKFAGSTWTYYVKKIRIILGREPANPSPKGKNEDLEVIDMN
FGPSKVVSRKHAVVEYDLDDQTWNCSVYGRNGIKVDGKLFKNGETVKLTSGSILEVAGLQ
MMFVLPNAAEQKQTDESTIKEDAIKSEISAAVNDAAEYGDNKKPPYSYSVMIAQAILSSS
ECMMTLSNIYSWISTHYPYYRTTKSGWQNSIRHNLSLNKAFRKVPRKSGEQGKGMKWSIV
PEFREEFIAKTRKTPRKRSPSSPVPLLAKKREGSPSLPIPILPKMKDTSIPAAEPASSTT
SARDQTPSTPKDVGSPSTAETSAEEKQMETYKTPTHAALSDIISTHDYALDANSASQTKK
AAFGSPIGSSTYPTSSPAPFWKYVAVPNPHDWPQVGSYDTISPYRNPVNSHLIYSQIQQS
SPKKIDEQLHDLQGVDLVNGFEGISSWRESMVNKLRSSVSDSPTMNLANSNSKSSPVAVQ
RVSTLPQASANKQAKEMESKMSNSPTQKSKTEENNQAVRAILDASATMEKQYDLHRLPTP
TSQTESASVPQIANPPNSQNLVKEKSPQQYIQVPQSNVKSSA
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgactgttcgcagactcgaaagcaagtctgagcatatatcagatgacgaggagagaaaa
gaacagttagattacaaaaagcaaatggatgtagacacagatcgtaacattgtattgaat
ggtcgcctggaatcccaaattgcgaagttgtccgttccacctcacgaaatgagagtggtc
gatgattattcgaacagtaaaaatgcggaaagacactctggagaaatacaagcttatgcg
aaattcgctggaagtacatggacttattatgttaagaaaattcgaattatacttggtcgc
gaaccagcaaatccttcaccaaaggggaaaaatgaagatttagaagtaattgatatgaat
tttggtccttctaaagttgtgagtcgaaaacacgctgttgtggaatatgatttggatgac
caaacatggaattgctcagtttacggtcgaaatggcattaaagtagatggcaagttattc
aagaatggggaaacagtcaagcttacaagtggatctatactcgaagtagcgggtttacaa
atgatgttcgtactacccaatgcagctgagcaaaagcaaactgacgaaagcactataaag
gaggatgctataaagtctgaaatttccgcagccgtaaacgatgctgctgaatatggtgat
aataaaaaaccaccatacagttattctgttatgattgcacaagcaattttatcttcttct
gaatgcatgatgactctttctaacatatattcatggatttcaacacattacccatattat
cgcacaacaaaaagtggatggcagaattctatccgtcacaatttatctctcaacaaagca
tttcgaaaggttccacggaagtcaggtgagcaggggaagggaatgaagtggtcgattgtg
cctgaatttcgcgaagagtttattgcaaagactagaaaaacaccgcgtaaacgctcgccc
tcctctcctgtgccattattagcaaaaaagagagagggttctccatcattaccaattccc
atccttccgaaaatgaaggacacctctattccggcggcggagccagcctcatccactaca
tctgctcgtgatcaaactccttcaactcctaaagatgtgggctcaccctcgactgctgaa
acctcagcagaagaaaagcaaatggaaacctacaaaacgcctacacatgctgcattatct
gatattattagcacccatgattatgctttagatgctaatagtgcttctcaaacaaaaaag
gctgcatttggatctcctattggatcttctacatatccaacgtcttctcctgcacctttt
tggaaatatgttgcagttcccaatccacacgattggcctcaagtaggttcatatgacaca
atttcaccttacagaaatccggtcaatagtcacttgatatactctcaaatacagcaatct
tcaccgaaaaagattgatgaacaattacatgatttacaaggtgttgatttggtcaatggt
tttgaagggattagctcctggagagaatctatggtaaataagttacgctcttcagtttcc
gactcaccgacaatgaatcttgcgaattccaacagtaaatcttctcctgtcgccgttcaa
cgtgtttcaactttaccacaagcctctgcgaacaagcaagccaaggaaatggaaagcaaa
atgagtaactccccgactcaaaagtcaaaaacagaagaaaataatcaagctgtccgcgca
atattagatgctagcgccacaatggaaaagcagtatgacttacacagattacccacccca
acttcacaaacagagtcggcttcagtgcctcaaattgctaatcctcccaattcacaaaac
ctcgttaaagaaaaatctccccagcagtacattcaggttcctcaatctaatgttaaaagt
agtgcttaa

DBGET integrated database retrieval system