KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16G5.18
Entry
SPBC16G5.18       CDS       T00076                                 

Gene name
erg24
Definition
(RefSeq) putative C-14 sterol reductase Erg24
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00100  Steroid biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Module
spo_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SPBC16G5.18 (erg24)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SPBC16G5.18 (erg24)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 2540113
NCBI-ProteinID: NP_596767
PomBase: SPBC16G5.18
UniProt: Q09195
Position
II:4250067..4251341
AA seq 424 aa
MAKGAVKKEKFEYEFFGPIGALGVTVLTTVVSFGSFYICNEEGCPAKFSKISHIFKKTPL
FDQKSLILYLLWFSTLTLLWKCTNGKWAKGTPIDDKGTRLLYKINGFNSACLILGVVCTS
IYLLGASCMEFIWDNFLQLMFAAYVFSVVLCTFCYVQSFFGKQQLAKGGTSGNILFDWFI
GRSLNPRIGNFDIKCFCELRPGLILWVVFDIAFACHQYLVLGGRITDSMVLVIIFHTWYV
LDSLINESAVLTTMDITTDGFGYMLSFGDLVWVPFLYSLQARYLAFHPVDLGLVKTLAIL
CLQFLGYYIFRGANGQKNRFRSNPNDPKLKHLKFIQTKRGTKLLTSGWWGMARHINYFGD
WIMAWAWCLPAGFGSPIPYFYVAYFGVLLVHRNARDDHKCRVKYGEDWEKYCKAVKYRII
PYVY
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggctaaaggtgcggtaaaaaaggagaaattcgaatatgaattttttgggcccattggc
gctttaggtgttactgttttaacgaccgtcgtatcttttggttcattttatatctgtaat
gaggaaggatgcccggctaaattctctaaaatctctcatatatttaaaaaaactcctcta
tttgaccaaaagtctttaattttgtacttgctttggtttagtactctcactttgttatgg
aaatgcacgaatggaaaatgggcaaagggtacacctatagacgacaaagggacaagatta
ctttataaaataaatggttttaactcagcttgcctaatacttggtgtcgtttgtacctca
atatacctgttgggagctagctgcatggaatttatttgggataactttttacagttgatg
tttgctgcatacgttttttcagtagttttatgcacgttttgctacgttcagtcttttttt
ggaaagcagcaacttgctaaaggggggacttctggaaacattttatttgactggtttatt
ggccgcagcctcaatcctagaataggcaattttgatatcaagtgtttttgtgaacttcgt
cccggtctaattttatgggtcgtttttgacattgcttttgcatgccatcagtacctggtg
ttaggaggtagaattacagacagcatggttctggttattattttccatacatggtatgtt
ctggattctctaatcaacgagagtgctgttttgactaccatggacattaccacagatggg
tttggctacatgctgagctttggggatctcgtgtgggttccatttctctattctttgcaa
gctcgctatttagcctttcatcccgtggatttaggacttgtcaaaacattggcgatttta
tgcttacagttccttggatactatattttccgtggcgccaatggtcagaagaataggttc
cgaagcaatcctaacgatcccaagctcaaacacttaaaatttatccagactaaacgtgga
actaaacttttaactagtggttggtggggaatggcacgccacatcaactattttggtgat
tggattatggcttgggcttggtgtttacctgctggatttggttcaccgatcccgtacttt
tatgttgcctattttggtgtgcttcttgttcatagaaatgcacgggatgatcacaaatgc
cgtgtaaagtatggtgaagattgggagaagtactgcaaggcagtcaaatatcgtattatt
ccctatgtgtattga

DBGET integrated database retrieval system