KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.05c
Entry
SPBC16H5.05c      CDS       T00076                                 

Gene name
cyp7
Definition
(RefSeq) putative cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp7
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC16H5.05c (cyp7)
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC16H5.05c (cyp7)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPBC16H5.05c (cyp7)
Spliceosome [BR:spo03041]
 Complex C
  Other components
   PPlases
    SPBC16H5.05c (cyp7)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPBC16H5.05c (cyp7)
SSDB
Motif
Pfam: Pro_isomerase Dict-STAT-coil
Other DBs
NCBI-GeneID: 2540067
NCBI-ProteinID: NP_001342715
PomBase: SPBC16H5.05c
Position
II:join(2291578..2291583,2291624..2291652,2291695..2291799,2291890..2293141)
AA seq 463 aa
MATLTNLEPLATGTVILKTTRGDIQIELWCKEVPKACRNFIQLCLEGYYDGTIVHRVVPE
FLIQGGDPTGTGMGGESIYGEPFAVETHPRLRFIRRGLVGMACTENEGNNSQFFITLGPT
PEWNGKQTLFGRVVGDTIYNVVRISELELDANQRPVFPPKIISTEVIDNYFTDIKPRSTK
EEREKIANELAHQEKQKERNKLLKSGRRNKAVLSFGDEVDMPIVKKPLRQKTPVSRSSDT
TTELSKDLISSSSSIHSTYSSAQTGLTSAKVSSDEYARQVDTLDTKLNSSSKSKVQEEIS
RLKSELRDLEKSGGSSNSKPVVVRPKKRNILTEELEKYKKSKKVVLGKRKNLENDEESTL
RALSSFQSKIRNAEDEDVMDSQYGSKIEDTPCSLHNVPGCFSCFDRLGEKNITETNSNWF
AHRLVAENDPTRRTEELRIQRAEELKDVPSARPKKLLMKRDII
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggccactttgaccaacttggagcctttggcaacggggactgtcatccttaaaactact
cgcggcgatatccagatagaactttggtgcaaagaagtgccgaaggcctgtagaaacttt
atacagttatgcttggaaggttattacgatggaaccattgttcatagagttgtaccagag
tttttgatacagggtggagatcctactggcactggaatgggtggtgaatctatatatggt
gaaccttttgctgtagaaacacatcctaggttacggtttataagaagaggattagtggga
atggcatgtactgaaaatgagggaaacaactctcaattttttatcaccttaggtccaaca
cctgaatggaatggcaagcaaactctatttggacgtgttgtaggggataccatttacaat
gtagtaaggatatctgagttagagttagatgccaaccaacgacctgtttttcccccaaaa
ataatttcaacagaggtaattgacaattattttactgacataaaacctcgttcaactaaa
gaagaaagagagaaaattgccaatgagctagcccaccaggaaaaacagaaagaaagaaac
aaattattgaaatccggacgacgaaataaagcagttctcagttttggcgatgaagtcgat
atgcctattgtaaaaaagccgctcaggcagaaaacgccagtatccagatcatctgatact
acgactgagttaagtaaagatttgatttcatcttcatcctcaattcacagtacttactcg
tctgcccaaactggattgacctctgctaaagtctcttccgatgaatatgctaggcaagta
gacactttagatacaaagttaaattcttcctctaagtccaaggtacaagaagaaatttcc
cgtttgaagtctgaacttcgtgacttagaaaaaagtggtggctcttcaaactcgaaaccc
gtggttgtacgtcctaaaaaacggaacatcttgactgaggaacttgaaaagtataaaaaa
tccaaaaaagttgtcttagggaagcgaaaaaacttggagaatgacgaagagtcgaccctt
cgagcactttcatcatttcaaagcaagattcgaaatgcagaagatgaagatgtcatggat
agtcaatatggtagcaaaatagaagacacaccttgcagcttacacaatgttcctggttgc
ttttcatgttttgataggcttggcgaaaaaaatataacagaaacgaacagcaactggttt
gcgcatcgattggtggctgaaaatgatccaacaagaagaacggaagaacttcgaatacaa
cgagcagaagagcttaaagatgttccaagtgctaggcctaagaagcttttaatgaaacgc
gatataatttaa

DBGET integrated database retrieval system