KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16H5.11c
Entry
SPBC16H5.11c      CDS       T00076                                 

Gene name
skb1
Definition
(RefSeq) protein arginine N-methyltransferase Skb1
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  RNA transport
spo04011  MAPK signaling pathway - yeast
spo04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    SPBC16H5.11c (skb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPBC16H5.11c (skb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBC16H5.11c (skb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC16H5.11c (skb1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC16H5.11c (skb1)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     SPBC16H5.11c (skb1)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SPBC16H5.11c (skb1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     SPBC16H5.11c (skb1)
SSDB
Motif
Pfam: PRMT5_TIM PRMT5 PRMT5_C
Other DBs
NCBI-GeneID: 2540099
NCBI-ProteinID: NP_595936
PomBase: SPBC16H5.11c
UniProt: P78963
Position
II:join(2277215..2277464,2277514..2279012,2279059..2279247)
AA seq 645 aa
MLLRDGRIPQYSIYPLPVPPMNSKTPTLGIVCSEGTISLSLEEGFEFVGVPLSGEGLKLR
VEALAPSERLQEFLDDEVAYHPEENVHKVVGLSSAWLELDSEDTLIADRSEEVLLKEASY
ASYCGLSSIILNGPTSPMNVMRYARAVSSALNSTMNLKFLVQLAIESGHEDYFETWKMWD
TIRSACGYHPRLKVALELPPACSPPIELVNRWYAEPIEMITMSCMAFVPNPNGYPVLGRK
LRAIYALYLRLNPRILLWDNDAPEKIGDSPDYSIYMKHLFDSQPPAPLVEDLADSYKDYL
QVPLQPLSYNLENITYEIFERDPVKYAQYEQAIFSALMDRDESSVTRIAVVGAGRGPLVD
CALRAAISSSRTVDMIALEKNPNAFSMLLMRNRQDWAGKVTLVFGDMRTWNPDYKIDILV
SELLGSMGDNELSPECLDGVQHVLDEETGICIPSSYISYVTPIMSPKLWSEARNMNDPNA
FERQYVVLMNSFDFLAADDEFRFQSLWSFHHPNKDSEVYTKNLHNKRFASVRFQASSPGI
LHGFAGYFEATLYKDISLSIMPATMEAKSPDMFSWFPIYMPIKKPMYVPENSQLEFHMWR
LTDGMRVWFEWCANAYLVLRNGSQIKLSSTEVHNISGKAFSCNMY
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgttattgcgggatggccgtattccacagtacagtatttacccattgccagttccgccg
atgaattctaaaacgcccactctaggaatagtttgttcagaggggaccatttccttgtct
ttggaagagggttttgagtttgttggagttccgttaagtggtgaaggtttaaagctacga
gttgaagctctagctccgtcagagcgtttgcaggaattcctcgacgatgaagtagcttat
caccctgaggaaaatgtgcacaaggtggtcggtttatcctcagcttggctggagttagat
tctgaagacacactaatcgctgatcgatcagaagaagtgttattaaaggaagcatcatat
gcttcttattgtgggttatcttcaatcatcctaaatggtccaacttcaccaatgaacgtt
atgcgttatgcgagagctgtatcttctgctttaaactcaacaatgaatctaaaattcttg
gtacaattggcaatcgaaagtggtcatgaagactattttgagacatggaaaatgtgggac
acaattcgctcagcatgtggttatcaccctagattgaaggtggccttagagctacctccc
gcttgttcacccccaatcgagctagtaaatcgatggtacgcggaaccgatagagatgatt
actatgtcatgtatggctttcgttcctaatcccaacggctatccagtacttggtcgtaag
ttgagggctatttatgctttatatctacgtctcaatcctcgaattttactttgggataat
gacgcacccgagaaaataggtgattcccccgactacagcatatatatgaagcacctcttt
gattcacagcctccagctccacttgtagaagatctcgcggattcttataaagactatctg
caagttcctcttcaaccattgagctacaatttggaaaacattacttatgaaatatttgag
cgagatcccgttaagtacgcccagtatgagcaagcaattttttctgcgttgatggataga
gacgaatcttctgtcacgcgaattgccgttgtgggtgcgggaagaggtccattagtcgac
tgtgctttacgtgcggcaatttcttcatctagaacggttgatatgatcgcccttgagaaa
aatcctaacgctttttccatgctattgatgagaaaccgccaggattgggctggcaaagtt
actctagtatttggagatatgagaacatggaatcctgattataaaattgacatccttgtt
agtgaacttttgggtagtatgggagacaatgaacttagtccggagtgtctagatggtgta
caacatgtgcttgatgaagaaactgggatatgcattccatcttcttacatctcctatgtt
actcctattatgtctcctaagctatggtctgaagctcgtaatatgaatgacccaaatgct
tttgaaagacagtacgtggttttaatgaactcatttgactttttggctgcagatgatgag
ttccgttttcagtccctttggtccttccatcacccaaacaaagatagtgaggtttatact
aaaaacttgcataacaaacgttttgctagtgttcgttttcaggcctctagtcctggaatc
cttcacggttttgcaggatattttgaagctacattatataaggatatttctctttcaatt
atgccagcaactatggaagcgaagtctcctgacatgttttcatggttccctatttatatg
cccattaagaaacccatgtacgtcccagaaaacagccaattggaatttcacatgtggcga
ttgacggacggtatgcgggtttggtttgagtggtgtgccaatgcctatctggtgttgcgg
aatggaagtcaaatcaagttgtcttctacggaggtccacaacatttccggaaaagcgttc
tcgtgtaatatgtattaa

DBGET integrated database retrieval system