KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1703.03c
Entry
SPBC1703.03c      CDS       T00076                                 

Definition
(RefSeq) ARM-like repeat-containing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Arm
Other DBs
NCBI-GeneID: 2539718
NCBI-ProteinID: NP_596198
PomBase: SPBC1703.03c
UniProt: Q9P7W7
Position
II:complement(join(2918968..2920833,2920919..2921047))
AA seq 664 aa
MGRANGKRRNHRKNRMNPIQKKGFLEQEIPLNNSEAALPLLSRLDNPEIKERSWACSAIS
NIIASCTEGRLYLLKNGLVSKLIDRISDDSVEVVVEATGALRNLAIEEGYSICMDMYRKN
VLAPLQIWQTKIVQTLDEATEGKNVLETYEDRSTFSCLCAIAENISSLLVNLGETTSQVI
KVLNQKNTLVFLSRLLIPEAKIPQSVQEMALQAFFTLTDDNDDGIITWIQNSSDFALKTI
NQIYLYFSYPSCLVRVYSIGIIYNIYQSGFVNKKMESVVKGISLFDSFIPEALPILSDLL
PSEENYRNLVRQVYDKDTYFKTKKDDLTLSSELLVIPATLELISSMTSLLQSLADGTDEL
EEQEDSLMEDEDLSYMDDMSNVVNEDENLIIDEIPSNTPQKGNFKLVEYMLDHVLPKVIT
YCVVAFEFSSEEIPSNLSNYFQEVGDRTIECLNNISWSCNSVFVESSEAFTRWKLSAGKI
LQWIFQTIFLRLGLGVWPFSSEGFTTACSLLWSVSKPFPAEIQVLSVDDISTLILFSSTH
GSLEAQSRLLGAFGSLGRCGNIQINQLLGQTLMSCVIASDPNPLLAVEALNAIFDVYGDK
SYPYDAPVFKGSGYLSQLSEALPRLKNMVKKIDRRREKHLRFRAEEALENLESFIDYKHA
EYAS
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggggagggctaatggaaaacgaagaaaccataggaaaaatagaatgaatcccattcaa
aaaaagggctttctggagcaagagatccctttaaacaacagtgaagcagctctaccttta
ctcagtcggcttgacaatccagaaataaaagagcgatcttgggcttgcagtgctatttca
aatatcattgctagttgcactgaaggtcgcttatatcttttgaagaatggtttagtatct
aagcttattgatcgtattagtgacgattctgtagaagtagtagttgaagctacaggcgct
cttcgcaatctggctattgaggaaggatactctatttgtatggatatgtacagaaagaat
gtgctagcacctctacaaatttggcaaacaaagatagtccaaacccttgacgaagcaact
gaaggaaaaaatgttttagaaacatatgaagatcgcagcacgtttagctgcctatgtgct
atcgcagagaatattagttccttgcttgtaaacttgggagaaacaacgtcacaagtaatc
aaagttctaaaccagaaaaacacattggtttttctttctcgtctattaattccggaagct
aaaattccacaatctgttcaggaaatggctttgcaggccttcttcactcttactgatgat
aatgacgatggcataattacttggattcaaaattcatctgacttcgcgttaaagacaata
aatcagatttatctttacttttcatatccatcgtgtcttgtccgtgtctactcaattggt
attatatataatatataccagtctggctttgttaataaaaaaatggaaagtgttgttaaa
ggaattagtttgtttgactcattcattccagaggcacttcccattttatctgatttactt
ccttcagaagagaactataggaaccttgtccgacaggtgtatgacaaagatacatatttt
aagaccaaaaaggatgatttaacactctcatcggagcttctagttattccagctacttta
gagcttatttcttcaatgacttcacttttacaaagtttagctgacggtaccgatgagcta
gaagaacaagaagactcattaatggaggacgaggatttgagctatatggatgatatgtct
aacgttgttaatgaagatgaaaatcttatcattgatgagattccatcgaatacaccacaa
aagggtaattttaaacttgtcgagtatatgttagatcatgttttacctaaggtaattact
tattgtgttgtggcattcgaattctcttctgaagagattccatcaaacttgagtaactac
tttcaagaagtcggtgatcgaactattgaatgtctaaataacatctcgtggtcctgtaat
agtgtttttgttgagtcttcggaagcttttactcgttggaagctttctgcaggtaaaata
ttacaatggattttccaaactatctttttgagactaggcttaggagtttggccttttagc
tcagaaggtttcacaacggcttgtagtctactctggtctgtctcgaagccctttccggct
gaaattcaagttctttcagtagatgatatttctaccttgattttattcagctcgactcat
ggttcgttggaagcacaatctaggttgctcggtgcctttggaagtttaggacgctgtggc
aacatacaaataaaccaacttcttgggcagactttaatgtcatgtgtaatagcttctgat
ccaaatcctctacttgcagtggaggcattgaatgccatatttgatgtatacggcgataag
tcatatccatatgatgctcctgtttttaagggatccggatatctttcacaactttcagaa
gccctaccgcgattaaaaaatatggtgaaaaaaattgaccgtcgtcgagaaaagcatttg
cggttccgtgctgaagaagctttagaaaatttagaatcttttatagattacaaacatgct
gaatatgcttcataa

DBGET integrated database retrieval system