KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1703.04
Entry
SPBC1703.04       CDS       T00076                                 
Symbol
mlh1
Name
(RefSeq) putative MutL family protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPBC1703.04 (mlh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC1703.04 (mlh1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     SPBC1703.04 (mlh1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 2539949
NCBI-ProteinID: NP_596199
PomBase: SPBC1703.04
Ensembl: SPBC1703.04
UniProt: Q9P7W6
Position
II:2921150..2923544
AA seq 684 aa
MDVNSRAKIRPLDQLVINKIAAGEIIERPENAIKELIENSLDAGSTSIDVLLKDGGLKLL
QITDNGSGIQYDDLPYLCQRFSTSKIDNFNDLQHLQTFGFRGEALASISHVAKVTVVTKL
SSDIHAWKAFYVDGALAPISPGMSPAPQPCAGKQGTVITAEDLFYNVRSRKSALKNGSEE
FRRIMILVQKYAIHNDQVSFNCKKVGDTVASLSLSSRLSKADKIRHIYGPRVASHLRDFS
LGEGQSSIVGFSANGFISNADFQDKKSNLILFINNRLVESVELRHALEETYAKYLHKGAS
YFVYLSLNMSPEQLDVNVHPSKRIVHFLYDQEIATSICDKLGEILERTDTERSYPLQAMI
PSISNTKNAESSSQKAVRTYENYLVRTDPRERSIKSMLSDNFLQRSSNNYDNEIIEKVDS
ANSNKNATNDIKDLQTEEIVEEGNSIDLESIKSLQKQVINSMHVLATNILTEHKYVGLVC
PTRRIAAVQHNIGLYVVDYGKLSYHLFYQICLTEFGNYGEFVLETPLSISDLFEIVNGDE
DKSESEKFTRLLVSRRDMLKDYFSISVTSGGLLTAVPMLSPKYHPPFEQLPLLISSLTPK
FFDWLDEKSCLNGIMKAIAKFYVPLPLSYEESDVKSIRSLESCLEDYLFPEFRRRVICPK
KVFEEKCIYQITSLPRLYNVFERC
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggatgtcaattcacgagcaaaaattcgtcctttggatcaattggttattaacaaaata
gccgcaggggagattatagaaagacctgaaaatgctattaaagagttaattgaaaattca
cttgatgctgggagtacaagcattgatgttttgctaaaagatggcggcttgaagcttctt
caaattactgacaatggatctggtatacagtatgatgatcttccttatttatgccagagg
tttagtacgtctaaaattgataattttaatgatttacaacatttacaaacatttggattt
cgtggagaagcacttgcgagtatcagtcatgtcgcgaaagttacagtagtaacaaagctt
tcttcggatatacacgcatggaaggctttttatgttgatggagctcttgcgcccattagc
cctggaatgagtcctgctccccaaccttgtgctgggaagcaagggactgtaataacggct
gaagatttattttacaatgtacgtagtcgcaaatcagctttaaaaaatgggtcagaggaa
tttcgtcgcataatgatcttggttcaaaaatatgcaattcataatgaccaagtttcattc
aactgtaagaaggttggtgacaccgttgcctctttatctttaagctctaggctttccaaa
gcggataaaattagacatatttatggaccaagagtggctagtcatttgagagatttttct
ttaggagaaggacaatcgtctattgttggattttcggccaatggttttattagcaatgca
gactttcaagataaaaaaagcaatttaattttatttattaataatcgattagtggaatcg
gttgaactgcgacacgctcttgaggagacttatgctaaataccttcataaaggagcatct
tactttgtttacttatcgttaaatatgagtcctgagcaattggatgttaatgtccatcct
tcgaagaggattgttcattttttgtatgaccaagagattgcaacttctatctgtgataaa
ctaggtgaaattttggaacggacggacactgaaaggtcgtatcctttgcaagcaatgatt
cctagcatctctaataccaaaaacgctgaaagctctagtcaaaaagcagtgcgaacctat
gaaaattatttggttcgtacagatccgcgtgaaagaagtattaaaagtatgctttcagat
aactttttgcagcgatcatcaaataattatgacaatgaaataattgaaaaagttgattcg
gccaactcgaataaaaatgcaacaaatgacataaaagatcttcaaactgaagaaattgtt
gaagaagggaattctattgatttggaaagcatcaagtctttacaaaagcaagttataaat
tcaatgcatgtcctggcgactaatattcttacggagcataagtatgtaggtttagtttgt
cctacaagaagaattgcggcggttcagcataacataggtttatatgtggtcgactacgga
aagctttcatatcatctgttttatcagatttgtctcactgaatttggaaattacggcgaa
tttgtactcgaaacacctttgtcaatttccgatttatttgaaatagtcaatggtgatgaa
gacaaatctgaaagtgaaaaatttacacgtttattagtttcccgacgagatatgttaaag
gactacttttctataagtgtcacgtcaggtggattattgacagctgtaccgatgttaagt
cctaaatatcatccaccttttgagcaacttcctttgttaattagtagtttgactcctaag
ttttttgattggttagatgagaagtcatgtttaaatggaatcatgaaagcaattgcaaaa
ttttatgtccctctccctctttcttatgaagaaagtgatgtgaagagcatcagatccttg
gagtcatgcttagaagattatttgtttcctgaatttcgccgaagggtaatttgcccaaaa
aaagtatttgaagagaagtgcatatatcagatcacgagtttaccgcggctctataatgtt
ttcgaacgttgttaa

DBGET integrated database retrieval system