KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1703.07
Entry
SPBC1703.07       CDS       T00076                                 
Name
(RefSeq) putative ATP citrate synthase subunit 1
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00020  Citrate cycle (TCA cycle)
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPBC1703.07
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC1703.07
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     SPBC1703.07
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC1703.07
  Exosomal proteins of bladder cancer cells
   SPBC1703.07
  Exosomal proteins of melanoma cells
   SPBC1703.07
SSDB
Motif
Pfam: CoA_binding Citrate_synt Ligase_CoA Succ_CoA_lig
Other DBs
NCBI-GeneID: 2539879
NCBI-ProteinID: NP_596202
PomBase: SPBC1703.07
UniProt: Q9P7W3
Position
II:join(2928014..2928173,2928221..2928294,2928559..2930172)
AA seq 615 aa
MAGSVDKPSYELFSKDTRAFVYGMQTKAVQGMLDFDYMCGRTVPSVAAIIYTFGSQSISK
LYWGTKEILLPVYRTIEEACTKHPEVDVVVNFASSRSAYASTMELMEFPQIRCIAIIAEG
VPERRAREILVTSKEKNVVIIGPATVGGIKPGCFKIGNTGGMMDNIVASKLYRPGSVAYV
SKSGGMSNELNNIISHTTDGVYEGIAIGGDRYPGTTFIDHLIRFEADPACKLMVLLGEVG
GVEEYRVIEAVKNGTIKKPIVAWAIGTCSSMFKTEVQFGHAGSFANSELETAVAKNQAMR
EAGIYVPETFEKLPALLQEVYEGLVKKGVIVPQPEVAPPNIPLDYAWAKELGLVRKPSSF
ICTISNDRGSELTYNNVPISKVFEEELGIGGVISLLWLRRRLPSYATKFLEMVLQLTADH
GPCVSGAMNTIITTRAGKDLISSLVAGLLTIGTRFGGALDGAAQEFSKAYDAGLSPRAFV
DSCRKANKLIPGIGHRIKSRNNPDLRVELVKGYVKKNFPSTKLLDYALAVENVTTSKKDN
LILNVDGCIAVCFVDLLRNCGAFTLEEANEYINLGILNGMFVLGRSIGLIGHHLDQKRLR
APLYRHPWDDFLYLS
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcgggatcagtggataaaccttcttatgagcttttttccaaggacaccagagccttt
gtgtatggcatgcagacaaaggctgttcaaggaatgcttgactttgattatatgtgtggt
agaactgttccatctgtagctgctatcatatatacgttcggaagtcaaagtatcagcaag
ctttattggggtactaaagaaattctgttgcctgtttatcgtacaattgaagaagcatgt
accaaacatcctgaggttgacgtcgttgttaattttgcttcgagccgtagtgcttatgcc
tcaactatggagttgatggagtttcctcaaattcgctgtattgcaattattgcggaaggt
gtccctgagcgccgtgctcgtgagatattggtaacctctaaggagaagaatgtggttatt
attgggcctgctaccgttggtggtattaaaccaggatgtttcaaaatcggaaatactggt
ggtatgatggacaacattgtagcttccaagctttatcgtcctggatctgttgcatacgtt
tccaagtcaggcggtatgtctaatgagttaaacaatatcatttcgcataccactgatggc
gtctatgagggtattgctattggaggtgaccgttatccaggtactacttttattgatcat
cttatccgcttcgaagctgatcccgcttgcaagctgatggtacttctaggcgaagtaggt
ggagtggaagaataccgtgtcattgaagctgttaagaacggtacaattaaaaagcctatt
gttgcttgggctattggtacatgctctagtatgtttaaaaccgaggttcaatttggacat
gctggttcatttgccaactctgagttggagactgctgtcgccaagaatcaggctatgaga
gaagctggtatatatgttcctgaaacatttgaaaagcttcctgcgttgctacaagaggtt
tatgagggtcttgtgaaaaagggtgttattgttcctcaacctgaggtcgcaccacctaac
attcctttagattatgcttgggctaaggaattaggcttggttcgtaagccctcttccttc
atttgcactatctccaacgaccgtggttctgagttgacttataacaacgttcccatctct
aaggtttttgaagaagaacttggaattggtggtgtcatttctcttttatggttgcgtcgc
cgcttaccttcatatgctacaaagttcttggaaatggtccttcaattgacggctgatcac
ggaccatgtgtgtctggcgctatgaataccattattactaccagagcaggaaaagatttg
atttcttcacttgttgccggtttgcttactatcggtacccgattcggtggtgcgcttgat
ggagctgctcaagagttttctaaagcttatgacgcagggttatctccacgtgcttttgtt
gactcttgccgtaaggccaacaaattgattcctggtattggacatagaattaagagtaga
aataatcctgatcttcgtgttgaattggtcaagggttacgttaaaaagaatttcccttca
actaagctcttagattacgctttggccgtagagaatgtcactacttccaagaaggataac
cttatcttgaacgttgatggctgtattgctgtatgctttgtcgatttacttcgtaactgt
ggtgctttcactcttgaagaagctaatgaatatatcaatttgggtatcttgaatggtatg
ttcgtgttgggacgtagtattggtcttattggtcatcatctcgatcagaaacgtcttagg
gcacctctttatcgtcacccttgggacgatttcttgtatttgtcttag

DBGET integrated database retrieval system