KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1703.08cHelp
Entry
SPBC1703.08c      CDS       T00076                                 

Definition
(RefSeq) 5-formyltetrahydrofolate cyclo-ligase (predicted)
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00670  One carbon pool by folate
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPBC1703.08c
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     SPBC1703.08c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-FTHF_cyc-lig PyrI
Motif
Other DBs
NCBI-GeneID: 2539626
NCBI-ProteinID: NP_596203
PomBase: SPBC1703.08c
UniProt: Q9P7W2
Position
II:complement(join(2930386..2930498,2930550..2930711,2930760..2930888,2930934..2931062,2931108..2931189))
Genome map
AA seq 204 aa AA seqDB search
MSLKKNQLRAILNSSLGKLADHIIDSQSISICKQVVELPEWKRCKNVCLYMNMPKKEVRT
RCLIDVAFKEGKNVFIPKCIGSHVMEMYQVFEKTESLTINKWGIAEPNGESRKIMDDETD
CELIIVPGVAFDEKLSRLGHGKGYYDNYISKYQSWALQKESRANMFKVGICLKEQILPNR
EIPMDTRDQKLDALVTPEKVIRNI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaaaagaatcaactacgtgctattttaaatagcagtttaggcaaacttgcg
gatcatattattgattctcaatcaatttccatttgcaaacaagtggtcgaattacccgaa
tggaaaagatgcaaaaatgtctgtctgtacatgaacatgccaaaaaaagaagtacgaact
agatgccttatagacgtggctttcaaagaaggcaaaaatgttttcatacctaaatgtatt
ggttcgcatgtaatggaaatgtatcaagttttcgagaaaactgagtccttgacgattaac
aaatggggtattgctgagcccaatggagaatcaagaaagattatggatgatgaaacagac
tgtgaacttataatagttccgggagtcgcttttgatgaaaaattatctagactagggcat
ggaaaggggtactatgacaattacatttccaagtatcaaagctgggcgttacaaaaggaa
tcacgagctaacatgttcaaagtgggaatttgccttaaagaacaaatacttccaaatcga
gaaatcccaatggataccagagaccaaaaactggatgcccttgttacgccggaaaaagta
atcagaaatatatag

DBGET integrated database retrieval system