KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1706.03
Entry
SPBC1706.03       CDS       T00076                                 

Gene name
fzo1
Definition
(RefSeq) putative dynamin-like GTPase fzo1
  KO
K06030  mitofusin 2 [EC:3.6.5.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC1706.03 (fzo1)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC1706.03 (fzo1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     SPBC1706.03 (fzo1)
Membrane trafficking [BR:spo04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    SPBC1706.03 (fzo1)
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    SPBC1706.03 (fzo1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    SPBC1706.03 (fzo1)
SSDB
Motif
Pfam: Dynamin_N MMR_HSR1 GTP_EFTU cobW AAA_29 Roc AAA_18 AAA_22 TsaE Sigma54_activat TRAP-gamma
Other DBs
NCBI-GeneID: 2539859
NCBI-ProteinID: NP_595241
PomBase: SPBC1706.03
UniProt: Q9USY7
Position
II:594472..596748
AA seq 758 aa
MEKSARQLSVAEQNGESGRLNNGYTSNNIQQYKDETNRHQFEYNQNRNQLLRSIHIIQNL
LNELDNYVDRSDCLFHSVWRTDKEKSKFSGNYYPFSPSKMNVITIDLSLRSSSTADEKLI
SQLGEEAHESLLKVHIEKANKHLFSLFSRVEDTSSKILITGDLNAGKSTLCNALVHKDIL
PEDQQPCTEVFCEVHDAELNDGKDCVHAIPHGLTYSHTDSSTYKVFPIEDLKRLVYETEN
WSMLIVYVNDGRPAHESLLHNGITDIALIDAPGLNTDSMKTTSVFACQEEIDVVVFVVNA
ENHFTLSATDFLRNASTEKSHIFIIVNKFDNIRDKERCKRLILEQIHTLSPGTFADAKDL
VHFVSCRVARDPNNREDALYSSFFQMENSLRSFILENRSKSKLAPVRRYLSGLVGDILNI
CEYNIKLIDFDINHLQQRLTDLSPKFRKVKHEQQFTYQKNESLVEATVQSISQHTHSELE
DAIDSLGSFASVKYSGFFFAYQYAISVRDAMQQYLEEKLLESEDYARKRTEEAVLCIQKD
VKDNFDSAVLPVFHANQMFIKKHRLQLQKHFRFELGLLDFIDLDLTERLGTWSASLSTIL
LVLGKTTPSFTTLGAFTGNLGYPIFKYFQNNSLQHLLVPVLGLASICVFGYVIYDIPRAL
PLKVAEKIKKSLRETDFCHNASIWIGTESRKVLNIPLNDLRRMFHQQWDKQRETISVAEN
DLRICQKARKFFGEIESRTREAKKKIMMVQLEGCDINY
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggagaagagtgcaaggcaattatcagtagccgaacagaatggtgaatcgggaagatta
aataatggatatacttcaaacaatattcagcagtataaagatgaaactaatcgtcatcag
ttcgagtataaccaaaataggaaccaattgttaagatccatccatattattcaaaatctg
ttaaatgaactggataattatgtagatcgatctgactgtttgttccacagtgtttggaga
accgataaagaaaaatctaaattttcaggaaattactatccatttagtccgtccaaaatg
aatgtgatcaccattgatctatcactgcggtcgtcgtcgactgctgatgaaaaattaatc
agtcaattgggcgaggaagctcatgaatctctactaaaagtacacatagagaaagcaaat
aagcatctcttttcacttttttctagagtagaagatacctcttcgaaaatccttatcacc
ggggatttaaacgcaggtaaatcgaccctttgcaatgctttggtacacaaagacattcta
ccagaagatcaacaaccttgtactgaggtattttgtgaagtgcacgatgctgaactcaat
gatggaaaagattgtgttcacgctattcctcatggactcacgtatagtcatactgactct
tcaacatataaagtttttccaatcgaggatttgaaacgccttgtttatgagacggaaaat
tggagcatgctaattgtatatgtcaatgatggaagaccggcacatgagagtttgcttcac
aatggaattacagatattgcacttattgatgctcctggcttgaatactgattccatgaag
acaacttcagtatttgcttgccaagaggaaattgacgttgtcgttttcgttgtaaacgct
gaaaatcattttaccctttctgctacagatttcttaagaaacgcctccactgagaaatcc
cacattttcattattgtgaacaaatttgataacatcagagataaagagagatgtaaacga
ttgatccttgaacaaattcataccctttctcctggtacttttgctgacgctaaagacttg
gtacattttgtgagctgtcgtgtcgctcgtgatccaaataatcgagaggatgctctatat
tcttctttttttcagatggaaaactctctccgtagcttcattctcgaaaatcgctcaaaa
tctaaacttgccccggtacgtagatacttgtcagggttagtcggtgatatacttaatatc
tgcgaatataacataaaacttatcgattttgatattaatcacttgcaacaacgtttgacg
gatctttctccaaaatttcgtaaggtaaaacatgagcagcaatttacctatcagaagaat
gaatctttagttgaagcgactgtgcaatctatttctcagcatacacattccgaattagaa
gatgctattgactcattaggttcttttgcttctgtcaagtattctggttttttctttgcc
taccagtatgcgatatccgtaagagacgccatgcaacaatatttagaagaaaaattgttg
gagtcagaagattatgctcgaaagaggaccgaagaagctgtcttatgtattcaaaaagat
gtaaaagataattttgactccgccgtccttccagtctttcatgccaaccaaatgtttatt
aagaaacatagattgcaactgcagaagcattttcgatttgaacttggcttgcttgatttt
atagatctagaccttactgagagattaggaacctggagcgcttcattgagtactattctc
ttggtccttggaaaaacaaccccttcatttacaacgcttggtgcatttactggaaatctt
ggttatccaatatttaaatattttcaaaataactcgcttcaacacttattggtcccggta
cttggtttagcaagtatttgcgtttttgggtatgttatttacgatatacctagagcactt
cctcttaaagttgcggaaaagataaaaaaatctttaagggagacagatttttgtcacaat
gctagtatttggataggtacagagagtcgtaaagttctcaatattccgttgaatgattta
cgaagaatgtttcaccaacaatgggataagcagcgcgagactatatctgtcgctgagaat
gacttacgaatttgtcaaaaagcaagaaagttttttggtgaaatagaaagccgaactcgt
gaagctaagaagaagataatgatggttcaattggagggatgtgatataaattattag

DBGET integrated database retrieval system