KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1709.02c
Entry
SPBC1709.02c      CDS       T00076                                 

Gene name
vrs1
Definition
(RefSeq) valine--tRNA (Val) ligase Vrs1/Vas1
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPBC1709.02c (vrs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC1709.02c (vrs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC1709.02c (vrs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     SPBC1709.02c (vrs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPBC1709.02c (vrs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPBC1709.02c (vrs1)
 Prokaryotic type
    SPBC1709.02c (vrs1)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1c PepSY
Other DBs
NCBI-GeneID: 2540197
NCBI-ProteinID: NP_595435
PomBase: SPBC1709.02c
UniProt: O75005
Position
II:complement(join(1098300..1101080,1101212..1101285,1101345..1101396,1101437..1101472))
AA seq 980 aa
MADKGCEAAQSKDSSAPGSGEPRPKTEKELERERQKAAKLEKYHAKLAAKKAKEEARKPK
LDKKAKIASPVAEYVEKTTPGEKKVLQDLDSPALKSYNPKAVESAWYDWWVKSGFFEPEF
GPDGKPKKEGVFVITSPPPNVTGALHIGHALTIAIQDSLARWNRMLGKTVLFLGGFDHAG
LSTQSVVEKKLWYTQKKTRHDYPRDKFVDIVWEWKEEYHNRIKNQMSRLGGSFDWTREAF
TMDENLSRAVVETFVRLHEENIIYRANRLVNWCTALQTTLSNLEVENVDVPGRTLLKVPG
YDEPVEVGVLTSIAYAVEGSDERIVIATTRPETLLGDTAVAVHPQDPRYKHLHGKFVKHP
FCNRSIPIICDDIIVDMEFGTGAVKITPAHDPNDYEVGKRHNLEFINIFTDDGLLNENCG
EFAGMKRFTARVKVVERLKELGLFVGTKENPMVIPLCGKTSDIIEPVMKPQWWVNQKEMA
AAAAEVVKSGEIEIAPDMSRREFIRWMENIQDWCISRQLWWGHRIPAYFVNLADEPSQDR
SEGRYWVTGRTLEQAEEKAKAAFPGKSFTLEQDEDVLDTWFSSGLWPFSTLGWPKDTSDY
ENFYPTTLMETGWDILFFWIARMVMLGLKLTGKIPFKRVFCHALVRDAQGRKMSKSLGNV
VDPIDVIEGISLQALHDKLLVGNLDSREVEKAKKGQRLSYPKGIPQCGTDALRFTLCSLT
TGGRDLNLDILRVEGYRKFCNKLYNATKFALGRLGSNFVPNKTADLTGNESLVEKWIFHR
LNIAAAAMNKNMEEMNFLQATSAVHQFWLYELCDVYIENSKYLLSDGTEVQQESAKQTLY
TVLDNALRLMHPFMPYVTEEMWQRLPRRPGDKTQTIVKAAFPVERVDYSNEIAAKYYESI
ITVVHSTRSMMAENGIKSDAVVYIHPDEEHSKLITSESASIQSLIKKCKTLSIVDNTFDS
DKCVKNEVLEGSTIFLERNN
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggcagacaaaggctgtgaagctgctcagtctaaggattcttccgcacctggttctggt
gagcctaggcctaaaaccgagaaagaattagagcgtgaacgccaaaaggcggctaagctt
gaaaagtatcatgcaaagctggcggccaagaaggcgaaggaggaggcaagaaagcctaaa
cttgataagaaggctaagattgcttcaccagttgccgagtatgtcgaaaagaccactcct
ggtgagaaaaaagtccttcaagacttggactctcctgctttgaagtcctataatcccaaa
gctgttgagtctgcttggtatgactggtgggtcaagtctggtttctttgaacccgagttt
ggtcctgatggtaaacctaagaaagagggcgtatttgttattacatctcctcctcccaat
gtcactggtgctttgcatattggccatgctcttacgattgctattcaagattcgttagct
cggtggaacagaatgcttggtaaaacagttttgtttctgggtggtttcgatcatgctggt
ttaagtacccaatctgttgttgaaaagaagctttggtacacgcagaagaagactcgccat
gattatcctcgtgataaatttgttgacattgtttgggaatggaaagaagaataccataac
cgtataaaaaaccaaatgtctcgacttggtggttcttttgattggactcgtgaagccttt
actatggatgaaaatcttagtcgtgccgttgttgaaacctttgttcgtttgcatgaggaa
aatattatctaccgtgctaatcgtctcgtgaattggtgtactgctttacaaacaacttta
tcaaaccttgaggtagaaaacgttgacgttcctggccgtactttgctcaaggtccctgga
tatgatgaacccgtcgaagtgggtgtattgacttccatcgcttatgccgttgaaggttct
gacgaacgaattgttattgctactacacgtccagaaacacttctcggagatactgctgtt
gctgttcatccccaggatcctcgttataagcacctacacggtaaatttgtaaaacatccc
ttctgtaaccgttcaattcctatcatctgtgacgacataatcgttgatatggaatttggt
accggtgctgttaaaatcactccagctcatgatcctaacgattatgaagttggaaagcgt
cataatttggagttcattaatattttcactgacgatggtcttctcaatgaaaattgtgga
gaatttgctggcatgaagcgttttactgctcgtgttaaggttgttgaacgactcaaggag
ctcggcttatttgttggtaccaaggaaaatccaatggtaattccactttgtgggaagact
tcggatattattgagccagtcatgaagcctcaatggtgggtgaatcaaaaagagatggct
gcagccgcagctgaagttgtaaagtctggtgaaatcgaaattgctcctgatatgtctcgc
cgagaattcattcgctggatggaaaatatccaagactggtgcatttctcgtcaattatgg
tggggtcatcgtatcccagcctattttgtaaatttagctgacgaaccttctcaagatcga
agtgaaggccgttattgggttactggtcgtactttggaacaagcagaagagaaagctaaa
gctgcttttcctggaaagtctttcacactagaacaggatgaagacgttcttgatacttgg
ttctcctccggattgtggcctttttctacccttggctggccaaaggatactagcgattat
gaaaatttctatcctactactctgatggaaacaggttgggatattcttttcttctggatt
gctcgtatggtaatgttgggtctcaaattaaccggaaagattccctttaaacgtgtattt
tgtcatgcactcgttcgtgatgctcaaggccgcaaaatgtctaaatcattgggaaatgtt
gtggatcctatagatgtcattgagggtatttctctacaagcattacatgataagcttttg
gttggcaatctcgacagcagagaggtcgaaaaagctaaaaagggtcaacggttgagctat
cccaagggtatacctcaatgtggaactgacgctttgcgttttaccctctgttccttgact
actggtggtcgtgatctcaaccttgatatccttcgtgttgaaggatatcgtaaattctgt
aacaagttgtacaatgctacaaaatttgctttgggtcgtctaggttctaatttcgttcct
aacaagactgccgatcttactggtaatgaatcacttgtagaaaagtggattttccaccgc
ttgaacatcgcagcagccgctatgaacaaaaacatggaagaaatgaacttccttcaagct
acttcagctgttcaccaattttggttgtatgaactttgtgatgtttacattgagaactca
aaataccttctaagtgatggtacagaggtacaacaagaatctgctaagcaaaccctctat
actgtccttgacaacgctcttcgtttaatgcatccttttatgccatacgttactgaagag
atgtggcagagacttcctcgtcgtcctggagacaaaactcagactatcgttaaagctgct
ttcccagttgaaagggtagactattctaacgagatagctgctaaatattacgagtctatc
attactgtcgttcactctactcgttcaatgatggctgaaaatggaatcaaatcagatgct
gtggtatacattcatcctgatgaagaacattccaaactcattacttcggaatctgccagt
attcaaagtcttatcaagaaatgcaaaactttaagcatcgttgataatacttttgattcg
gacaaatgcgttaaaaacgaggttttagaaggaagcactatctttttggaacgaaacaac
tag

DBGET integrated database retrieval system