KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1709.03
Entry
SPBC1709.03       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF3844
Other DBs
NCBI-GeneID: 2540196
NCBI-ProteinID: NP_595436
PomBase: SPBC1709.03
UniProt: O74728
Position
II:join(1102314..1102374,1102420..1103075,1103114..1103683)
AA seq 428 aa
MSLLRYFIFFIGGCTLALASGVSYTEASVYMSGLSGNENEVPSISPSDSRLVFAHKLGVS
RFHKLKSHSGARKIINEMLHSHSELSSFFYAEKSNTFLTIAGLAESELFDTLNPAFRISS
CPSSNAFASLMCRYERQLDSLDNGKTTDIYLNDIGGVISIHDSTGVYSQITTTPYKSLED
YEQLFGEDKASMFDISVKQDRVFLSEIYALKILVEFLSSKSQQERSDTSIVIGQLVGLEA
LYEKYGKDSKIYQVARENMMTLLSMIKQVSSTYTFILLPPIDSSETSTRYHKRQVDMEAF
GEEIEEVVASYEKNYNGRCYISEEACSKATNDCSGHGRCSKYGQLDSCYVCQCSNSVVSN
AAGQNKTIRWAGESCSKQDISVEFQFFFWFTIIGFGLLIFSIMLLFSIGQEELANVLTST
ATVIKKTT
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgagtctccttagatattttattttctttatcggtggatgtacattagctttggcctca
ggtgtttcatatactgaggcttcagtttatatgtcaggtctctctggtaatgaaaatgaa
gtcccttcaatttctccttcagattccaggcttgtatttgctcataaactgggcgtatca
cggttccacaagctgaaatcacatagcggtgctagaaaaattattaatgaaatgctccac
agtcattctgagctttcttcttttttttatgcagaaaagtctaatacttttttgacaatt
gccggattggcggagtctgaactgtttgatactctgaaccctgcttttcgcatctcttct
tgtccttccagtaatgcatttgccagtttaatgtgtcgatatgagcgtcagcttgattct
ttagataatggaaaaactactgatatatatttaaatgacattggcggagttatatcaatt
catgattcaactggcgtttattcacaaataactactactccctataaatctttagaagat
tacgagcagctttttggtgaggataaagcttctatgtttgacatatctgtcaagcaagat
agagttttcctttctgaaatatacgctctaaaaatccttgtcgaatttttaagctcaaaa
tcgcaacaagagcggtccgataccagtattgttatcggccaattagtcggattagaggct
ttgtatgagaaatatggtaaagattcaaagatttaccaagtagctcgcgagaatatgatg
actcttttgtcaatgattaagcaggtatcctccacatatacctttattttacttcctcct
atcgattcctccgaaacttctactagatatcataagcgtcaagtagacatggaagcattc
ggagaagaaatagaggaagtcgttgctagctatgaaaagaattacaatggtcgctgttat
atatctgaggaagcttgctcaaaggccaccaatgattgttctggtcatggaagatgttcc
aagtatggtcagttggactcctgttatgtctgccaatgttccaattccgtggtttcaaat
gctgctggccagaacaaaactattagatgggctggagaaagttgctctaagcaggatatc
tctgtggagtttcaatttttcttttggtttactattattggttttggactattaatattt
agcataatgttattgtttagcattggacaagaagaattggctaatgttttgacttctact
gcaacagtcatcaagaaaaccacataa

DBGET integrated database retrieval system