KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1709.05Help
Entry
SPBC1709.05       CDS       T00076                                 

Gene name
sks2
Definition
(RefSeq) ribosome-associated molecular chaperone Sks2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03040  Spliceosome
spo04141  Protein processing in endoplasmic reticulum
spo04144  Endocytosis
Module
spo_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPBC1709.05 (sks2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC1709.05 (sks2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPBC1709.05 (sks2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPBC1709.05 (sks2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC1709.05 (sks2)
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC1709.05 (sks2)
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPBC1709.05 (sks2)
   04131 Membrane trafficking [BR:spo04131]
    SPBC1709.05 (sks2)
   03051 Proteasome [BR:spo03051]
    SPBC1709.05 (sks2)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC1709.05 (sks2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC1709.05 (sks2)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     SPBC1709.05 (sks2)
Spliceosome [BR:spo03041]
 Complex B
  Other components
   Prp19 complex
    SPBC1709.05 (sks2)
 Complex C
   Prp19-CDC5 complex
    SPBC1709.05 (sks2)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    SPBC1709.05 (sks2)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP70 / DNAK
   SPBC1709.05 (sks2)
Membrane trafficking [BR:spo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    SPBC1709.05 (sks2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    SPBC1709.05 (sks2)
Proteasome [BR:spo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    SPBC1709.05 (sks2)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    SPBC1709.05 (sks2)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPBC1709.05 (sks2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR StbA FGGY_C RPA
Motif
Other DBs
NCBI-GeneID: 2540199
NCBI-ProteinID: NP_595438
PomBase: SPBC1709.05
UniProt: Q10284
Position
II:1106456..1108297
Genome map
AA seq 613 aa AA seqDB search
MSEVYEGAIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTETERLVGDAAKNQ
AAMNPRNTVFDAKRLIGRRYEDPETQKDIKHWPFKVIDNNGIPTIEVNYLGEKKQFTAQE
ISAMVLTKMKEISEAKLNKRVEKAVITVPAYFSDSQRAATKDAGAIAGLNVLRIINEPTA
AAIAYGLDAKSDKPKNVLIFDLGGGTFDVSLLKIQGGVFEVLATAGDTHLGGEDFDNALV
EHFIQEFKRKQKIDISDDPRALRRLRSACERAKRALSSVTQTTVEVDSLSNGIDFSSSIT
RARFEDINATTFKATIDPVAKVLKDSKVPKADVHDIVLVGGSTRIPKVQRLVSDFFDGRA
LNKSINPDEAVAYGAAVQAAVLTNKADSDKTQDLLLLDVVPLSLGVAMEGNVFGVVCPRN
TPIPTIKKRTFTTVADNQTTVTFPVYQGERVNCAENEPLGEFQLTGIPPMPRGQAELEAT
FELDANGILKVTAVEKTTGRSAHIEITNSVGHLSSTKIQEMIENADKFKQQDKDFAKKLE
AKSQLESYISNIETTISEPNVMMKLKRGDKSKIEAQLAECMSQLELEDTNTDALRKAELR
LKRTVQKAFASLR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtttatgaaggtgctattggtatcgacttgggtactacctactcttgcgtt
gctgtatgggaaaccgccaatgttgagattatccccaatgaccaaggtgcacgtaccact
ccctcatttgtcgctttcaccgaaactgagcgtttagtcggtgatgccgccaagaaccag
gctgctatgaaccctcgtaacaccgtttttgacgccaagcgtcttattggtcgtcgttac
gaagaccctgagactcaaaaggatattaagcactggccctttaaggttattgacaacaat
ggtatccctaccattgaggttaactatttgggcgagaaaaagcaatttactgctcaagaa
atttccgctatggttttgactaagatgaaggagatttccgaagctaagttgaacaagcgt
gtcgagaaggctgtcattaccgtccccgcctacttctctgactctcaacgtgctgctact
aaggatgctggtgccatcgctggccttaacgttcttcgtatcatcaacgagcccaccgct
gctgctattgcttacggtcttgatgccaagtccgacaagcccaaaaacgtcttgattttc
gatcttggtggtggtacttttgatgtttctcttttgaagattcaaggtggtgtctttgaa
gttttggctaccgctggtgacactcacttgggtggtgaagattttgataacgctttggtc
gagcactttattcaagaattcaagcgcaagcaaaagattgacatctctgacgatcctcgt
gctcttcgtcgtcttcgctctgcttgtgagcgtgctaagcgtgccttgtcttctgttact
caaaccaccgttgaggtcgactctctttccaacggtatcgacttctcttctagcattacc
cgtgctcgtttcgaggacatcaacgctaccacattcaaggctaccattgatccagtcgct
aaggtcttgaaggactccaaggtccctaaggctgatgttcacgacattgtccttgtcggt
ggttccacccgtattcccaaggttcaaagactcgtttctgatttctttgatggccgtgct
ttgaacaagtctatcaaccccgatgaggctgtcgcctacggtgctgctgttcaagccgct
gtcctcaccaacaaggctgactctgacaaaactcaagatttgcttttgttggatgttgtc
cccctttccttgggtgttgccatggaaggtaatgttttcggtgttgtttgccctcgcaat
actcccattcctaccatcaagaagcgtactttcaccactgttgctgacaaccaaaccacc
gttactttccctgtttaccaaggtgaacgtgtcaactgtgctgaaaacgaacctcttggt
gagttccaacttactggtatccctcctatgccccgtggtcaagctgagttggaagctact
ttcgagttggatgccaatggtatcttgaaggttaccgctgttgaaaagaccactggtcgc
tctgctcacattgaaatcaccaactctgttggtcatctttcttccactaagattcaagag
atgattgaaaacgctgacaagttcaagcaacaagacaaggatttcgccaagaaattagag
gctaagagccaactcgaatcttacatttctaacattgagactaccatctctgagcccaat
gtcatgatgaaattgaagcgtggtgacaagtctaagattgaagcccaattggctgagtgc
atgtctcaattagaacttgaggacactaacactgatgctctccgtaaggctgagcttcgt
cttaagcgtaccgttcaaaaggcctttgcatcccttcgttag

DBGET integrated database retrieval system