KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1711.03
Entry
SPBC1711.03       CDS       T00076                                 

Gene name
aim27
Definition
(RefSeq) putative protein Aim27
  KO
K23564  ER membrane protein complex subunit 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC1711.03 (aim27)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   ER membrane protein complex
    SPBC1711.03 (aim27)
SSDB
Motif
Pfam: EMC3_TMCO1 DUF5989
Other DBs
NCBI-GeneID: 2539739
NCBI-ProteinID: NP_595876
PomBase: SPBC1711.03
UniProt: Q9P787
Position
II:join(2138363..2138387,2138427..2138553,2138602..2138876,2139082..2139243,2139289..2139476)
AA seq 258 aa
MQKLLLDPALRNWVLLPIMFVMILIGILRHNATILLQSSPKKLSKEEIREQRLLQRAYAL
RACSNSLLPESIEARKCFLIESLKSGKYLKPVDPNAPKAANPLMDDKTLEGLMESMKGNM
LMVVPQTIIMTWINEFFSGFILLKLPFPLTLRFKSIFQSGVATQDLDVQWVSSISWYFLN
LFGLKSVYALLLGENNAASNATNEMGMAGFSSAAATAQLIQPGQDISKMMLSEAENVQIL
KNESLLVDVEKRLLAQFA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaaaagcttctgctggatccagctttgaggaactgggtacttttacccattatgttt
gtcatgattttgatcggaattttaagacataatgcaacaattttactccagtcttctcca
aaaaagctttctaaagaggaaattagagaacaacgactactacagcgcgcttatgccctc
cgcgcctgttcgaatagcttgctgcctgaatcaatagaagctagaaaatgtttcttaata
gaatcattgaaatcagggaaatatttaaaacctgttgatcccaacgctccaaaagctgca
aatccattaatggatgataaaactcttgagggtttgatggagtctatgaaaggaaatatg
ttaatggttgttcctcaaactattataatgacttggattaatgaatttttttcaggcttc
attctattgaaattaccatttcctcttaccttacgattcaagtcaattttccaatcaggt
gttgcgacacaagacttagacgttcaatgggtttcatcgatttcttggtattttctaaac
ttatttggtctcaaatcggtttatgcccttcttttgggagaaaataatgctgccagtaat
gctactaatgaaatggggatggctggtttttcatccgccgctgctacagctcagttaatc
caacctgggcaggatatttcgaagatgatgctttcagaagctgagaatgtacagattctt
aagaatgaatctcttttagtagatgtagagaaacgattactggcacaatttgcatag

DBGET integrated database retrieval system