KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1711.13
Entry
SPBC1711.13       CDS       T00076                                 

Gene name
his2
Definition
(RefSeq) putative histidinol dehydrogenase His2
  KO
K14152  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00340  Histidine metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SPBC1711.13 (his2)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SPBC1711.13 (his2)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SPBC1711.13 (his2)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     SPBC1711.13 (his2)
SSDB
Motif
Pfam: Histidinol_dh RHH_1
Other DBs
NCBI-GeneID: 2539650
NCBI-ProteinID: NP_595886
PomBase: SPBC1711.13
UniProt: Q9P777
Position
II:2159917..2161236
AA seq 439 aa
MPEYEIQVPSYRAAALTAEERTRLLARPIQNTQKIRTIVQPIIEDVKSRGEASLIDYASK
FEKVQLKSAVLKAPFDDDLMKISPMIKEDIDIAFNNIFAFHSSQLRPTIAVQTMRGVVCQ
RMSRPINRVGLYIPGGTAVLPSTALMLGVPAKVAGCPHVVISTPVRKDGTVAPEIVYIAN
KIGAEAIILAGGAQAIAAMAYGISGVPKVNKIFGPGNQFVTAAKMHVQNDYGALVAIDLP
AGPSEVLVIADETCNPESVALDLLSQAEHGLDSQIILLTVSLSPEMFDRIQKAINDHALR
LSRSYIIKHAIKKSVIVQVDNVDQAFEWSNLYGPEHLVLHLKNASSYIPKIDNAGSVFVG
PWSPVSMGDYASGTNHTLPTYGYASSYSGVSTDSFLKYITTQELTEEGIQRLGPTVIRLA
ELEGLTAHADAVRVRGVRL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgccggaatacgagattcaggtgccttcttatagagctgctgcattaaccgccgaagaa
cgtacacgattacttgcaagacccattcagaacactcaaaaaattcgtacgattgtccaa
ccgataatcgaggatgttaaatcaagaggagaagcttctctaatagattatgcttccaaa
tttgaaaaggttcaattgaagtcggctgtcttaaaggctccgtttgacgacgacttaatg
aaaatatccccaatgattaaagaggatattgatattgcttttaacaatatttttgctttc
cattcatcacagctgcgtcctacaattgctgttcaaaccatgcgtggtgtagtctgtcaa
cggatgtctcgtcctattaaccgagttggtctttatatccctggaggaactgcagtgttg
ccatctactgctttgatgcttggagttccggcgaaggtagctggctgtcctcatgtagtg
atttctacgccagtccgaaaggatggtacggttgcgcctgaaattgtatatattgcaaat
aaaattggtgctgaggctattattttggcaggcggggcgcaagcaattgcggccatggca
tatggaatatccggtgttcctaaagttaacaaaatttttggccctggaaatcaatttgtt
acagctgcaaagatgcatgttcagaatgattacggggctttagttgctattgatcttcct
gctggtccctcagaagttttggtaatagcagatgagacctgtaatcctgaaagtgttgcc
ttggatttattgtctcaagcagagcatggtttggacagtcagatcattttgctgactgtc
tctctatctcccgaaatgtttgaccgtattcaaaaagcaattaatgatcacgctttacga
ctttctcgttcgtatatcatcaaacatgctatcaagaagtcggttattgtacaggttgac
aatgttgatcaagcttttgaatggtctaatttgtatggtcctgagcacttggtcttgcac
ttaaaaaatgcttcttcatacattcccaaaatagataatgctggtagcgttttcgttggt
ccttggtcacctgtaagtatgggtgactatgcgtctggtaccaaccatacgcttcctaca
tacgggtacgcctcttcttattctggcgttagtaccgatagcttcttaaaatatatcact
acccaagagctcactgaagaaggaatccagcggttgggccctactgttattcgtcttgct
gagttggagggtctcactgcgcatgccgatgctgttcgtgttcggggagttagactttga

DBGET integrated database retrieval system