KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1718.02
Entry
SPBC1718.02       CDS       T00076                                 

Gene name
hop1
Definition
(RefSeq) synaptonemal complex-associated protein hop1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HORMA PHD PHD_2 MarR
Other DBs
NCBI-GeneID: 2540064
NCBI-ProteinID: NP_596448
PomBase: SPBC1718.02
UniProt: Q9P7P2
Position
II:join(3472319..3472413,3472462..3472609,3472654..3472822,3472861..3473101,3473142..3473532,3473580..3473805,3473853..3474169)
AA seq 528 aa
MNSYKEEILQTKSDFTLKNLIFFAISTLCYKRALFNENCYKKVNFEIEHFKGADFDCQLK
PTVVSLQAGVDKEADSFLEMMKTYIFSLVSMKVPFTVYLIISSQCKSILEDDAVEKEIFS
FTINPGSEEKICCESFVSYQRSERFVIKLFLSGNVKTECKDEEKVVQIITKMERFQLSKG
EATKAGVFLNTVETKDCMSWLNRGEFKDIVSFYESNNGIAISHCSHAFVPISTEKIMINK
ESSLFDSQEKIDSQLEKFLQPLKYDEIGSTQILDEQSVEKSLSQGKCEKMQNESRGLREI
KNNNPCEEVKKSNWLKKNISGSDKVDKAEKKKALLNCECGDSTEDSEMFQCERCDGWVHC
ACYGFESDSDPRQPNQLLCYTCLLVDSESSLYDRMTMLVAYRRAIRCIWASEYQGFQKLA
ARLNCSYADAKRIEERLVNENIIYKEKKRKWIYFTNKSPEMVSYLREKYFTPSRWISHLN
FQNYRQENQRVNMRSFLRPERMEVIERPKKVSKTSNTKETDTMKPLRI
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgaattcatacaaagaggaaattctgcaaactaagtctgactttactcttaaaaattta
attttcttcgcgatatcaacattatgctataagcgtgctcttttcaatgaaaactgctac
aagaaagtcaatttcgaaattgaacattttaaaggagctgactttgattgtcaattgaaa
cctactgtggtttctttacaagctggagtggacaaagaagcagacagttttttggaaatg
atgaaaacttatattttctcacttgtatcaatgaaagttccatttactgtttacctgatt
atttcgtcacaatgcaagtcaatattagaggatgacgcggttgaaaaggagatattttca
tttacaattaaccctggaagtgaagagaaaatatgttgtgagtcttttgtttcttatcaa
cgttcagaaaggtttgtaataaagttatttttaagtggtaacgtaaaaacagagtgcaaa
gacgaagaaaaagtcgtacaaattattacaaaaatggaacgctttcaattatcaaaagga
gaagcaactaaagctggcgtgtttttaaataccgtagaaacaaaagattgcatgtcttgg
ctcaatcgaggagaattcaaagatattgtatctttttatgaatcaaacaatggtattgcg
atttcacattgttctcatgcatttgtaccgataagtacagagaagatcatgattaataaa
gaatcatcattatttgattctcaagaaaaaattgattctcagctcgaaaagttcctccag
cctttgaaatacgatgaaataggctcaactcaaatattggatgaacaatcagttgaaaaa
agtttgagtcaaggaaaatgtgagaaaatgcagaatgaaagtcgtggattaagggaaata
aaaaataacaatccttgtgaagaagtaaagaaaagcaattggttaaaaaaaaacatttca
gggagtgacaaagttgacaaagccgaaaagaaaaaagcacttttgaattgtgaatgcggt
gattcgacggaagactcagaaatgtttcaatgcgaaagatgtgatggatgggttcactgt
gcttgctatggatttgagagtgactctgatcctcgccaaccaaaccaattgttatgttat
acatgtttgttagttgattctgaatctagtttgtatgaccgaatgaccatgttggtcgca
tacagacgagcaattcggtgtatttgggcgtcagagtatcaagggttccaaaagctagcg
gcgcgactgaattgcagctatgctgatgccaaaagaattgaagaaagattagttaacgaa
aacataatctataaggaaaaaaaacgaaaatggatatattttacgaataaaagccctgaa
atggtgtcatatcttcgtgagaagtattttacaccgtcgcgatggatatctcatctgaat
tttcaaaattatcgtcaagagaatcaacgtgtaaatatgcgatcttttctacggcccgaa
agaatggaagtaatagaaagaccaaaaaaggtttctaagacttcaaacactaaagagaca
gacaccatgaaacctctgaggatttaa

DBGET integrated database retrieval system