KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1734.02c
Entry
SPBC1734.02c      CDS       T00076                                 
Symbol
cdc27
Name
(RefSeq) DNA polymerase delta subunit Cdc27
  KO
K03504  DNA polymerase delta subunit 3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC1734.02c (cdc27)
   03410 Base excision repair
    SPBC1734.02c (cdc27)
   03420 Nucleotide excision repair
    SPBC1734.02c (cdc27)
   03430 Mismatch repair
    SPBC1734.02c (cdc27)
   03440 Homologous recombination
    SPBC1734.02c (cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPBC1734.02c (cdc27)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC1734.02c (cdc27)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC1734.02c (cdc27)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC1734.02c (cdc27)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    SPBC1734.02c (cdc27)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SPBC1734.02c (cdc27)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     SPBC1734.02c (cdc27)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 2539627
NCBI-ProteinID: NP_595419
PomBase: SPBC1734.02c
Ensembl: SPBC1734.02c
UniProt: P30261
Position
II:complement(1061718..1063538)
AA seq 372 aa
MEEWRNFLDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQGNDFLYPIYLIHGQPI
DDEINLEIDEESQPISNFPVLQYILCDKSSLQEKQSRLKSGYKTVIFALSSAPLSDFDEL
LPAVYEIREKDVLYKKEDADKYGFIFNENSVPRVLKKAPSTHSPQLSVPSKTSTIDKTDT
RSTEKTKGKDIFSNARNQKGNSSRKNKKAPLENHKEKEPLLPKEEKLSEQAKRERDDLKN
IMQLEDESVSTTSVHDSEDDNLDSNNFQLEIGTEAKSAAPDEPQEIIKSVSGGKRRGKRK
VKKYATTKDEEGFLVTKEEEVWESFSEDENISTGTSNVVRNKPTTVNIATKKKNTAQSKP
QQKSIMSFFGKK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggaggaatggagaaacttcttagatattaaagttatcaatgaatcttcacttgtaact
gtagataatttaagtctgcaattggatatatccagtgaaaaagcacaagaatatcttaat
atgttttatcaaggcaacgattttttgtatcctatataccttattcatggacaacctata
gatgatgaaattaatttggaaattgacgaggaatctcaacctatatctaattttcctgtt
ttgcaatacattttgtgtgataagtcttctctacaagagaaacaaagtagattgaaaagt
gggtataaaactgttatatttgctctttcatctgctccattaagtgattttgacgaatta
ttacctgcagtatatgaaataagagagaaagatgttttatacaaaaaagaagatgctgat
aagtatggatttattttcaatgaaaattccgtgcctcgtgttttgaaaaaggcaccttca
actcattccccccaattatctgttccctcaaagacatcgacaatcgataagactgacaca
cgtagtacagaaaagactaaagggaaagatattttcagtaatgcaaggaaccaaaaggga
aactcatctcgtaaaaataaaaaagctcctcttgaaaatcataaagaaaaggagcctctc
ttgccaaaggaggagaagttgtctgagcaagcaaagagagagcgcgatgatctgaaaaat
attatgcagctagaagatgaatcagtatctaccactagcgttcacgattctgaagatgat
aatttagattctaataatttccaattggaaattggtaccgaagcaaaatctgctgcacct
gacgaacctcaggaaattatcaaatccgtatccggtggaaagagacgtgggaaaagaaaa
gttaaaaagtacgcgacaacgaaagatgaagaaggattcttggttactaaggaagaagaa
gtctgggaatcattttctgaagatgaaaacatctcaactggtacttcaaatgttgttaga
aacaaaccgactactgtaaacattgcaactaagaagaagaatactgcacaaagtaaacca
caacaaaagtctattatgtccttttttggaaagaaataa

DBGET integrated database retrieval system