KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1734.08
Entry
SPBC1734.08       CDS       T00076                                 

Gene name
hse1
Definition
(RefSeq) STAM-like protein Hse1
  KO
K04705  signal transducing adaptor molecule
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPBC1734.08 (hse1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC1734.08 (hse1)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    SPBC1734.08 (hse1)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 GAT UIM DUF908
Other DBs
NCBI-GeneID: 2540055
NCBI-ProteinID: NP_595425
PomBase: SPBC1734.08
UniProt: O74749
Position
II:join(1074399..1074526,1074571..1074646,1074820..1075039,1075098..1075795)
AA seq 373 aa
MFRGKPNSIETLILQATDEKNTKEKWDVIMDACDQLSSTSGDVGRNSIKFLNKRLDTANA
NIQLLALTLTDAIVKNCKTSIVREISSRTFTDSLLKIASDSTTHNRVRSRIAVLVNEWAE
IMKKDPNMSLMQDICEKIRKLDIVDLRAPKKPEKEAMNELELKREEEELQYALALSLSES
TAQSNKVENPQSTKDEPLQKTNQRQESNLATSPASTVSRVRALYDFAATEQGELSFKKGD
IILVLESVYKDWWKGSCKNAVGIFPVNYVQRVVEPTIEQQRQSAHMEQQVFDALPQIDEL
LDTLSTTSPDAADDDALQGKYHAMIALRPKLVRLIEKYASQKEELMDLNERLLVARRDYE
KLYEQSMSEMRNF
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtttcgaggaaaacccaactctattgagacccttattttacaagccactgatgaaaag
aatactaaagagaaatgggacgttataatggatgcgtgcgatcaactatctagcacttct
ggagatgttggtcggaactcgattaaatttttaaataaaaggctggatacagcgaatgct
aatattcaattgttggctttgacgcttactgatgccattgtgaaaaattgtaagacttcc
attgtacgagagatctcctctagaacattcacggattctcttttgaaaatagctagtgac
tctacaactcataaccgagtgcgtagtagaatcgcagttcttgtcaacgaatgggctgaa
ataatgaaaaaagatcccaacatgagtcttatgcaagatatttgtgaaaaaattagaaag
ctagatatcgttgatttacgagctcctaaaaagccagaaaaagaagcgatgaatgaatta
gaactcaaaagagaagaagaggagcttcaatatgctttagcattatcactttcggaatcg
accgcgcaatcgaataaagtggaaaacccccaatccactaaagatgaaccgctgcagaaa
acgaaccaacggcaggaatcaaacttagctacttctcctgcttcgacagtttctcgcgtt
cgagcgctttatgatttcgcggcaaccgagcagggcgaactttcatttaaaaagggagat
attatattagtcctggaaagcgtgtataaagattggtggaaaggttcttgcaaaaatgct
gttggaatctttcccgtcaattatgtgcaacgagtcgttgagcctaccattgagcagcaa
cgtcaatctgcacatatggagcagcaagtttttgacgcgcttcctcaaatagatgaacta
cttgataccttatcgactacctctcctgatgctgccgatgatgatgctcttcaaggaaaa
tatcacgcgatgattgccctgcgtccaaagcttgtaagattaattgaaaaatacgcatct
cagaaagaagaactcatggatctgaatgaaaggcttttagttgctcgccgtgattatgaa
aaactttacgaacagtcaatgtctgagatgaggaatttttaa

DBGET integrated database retrieval system