KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1734.13
Entry
SPBC1734.13       CDS       T00076                                 

Gene name
atp3
Definition
(RefSeq) putative F1-ATPase gamma subunit atp3
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPBC1734.13 (atp3)
SSDB
Motif
Pfam: ATP-synt phiKZ_IP Fib_alpha
Other DBs
NCBI-GeneID: 2539839
NCBI-ProteinID: NP_595430
PomBase: SPBC1734.13
UniProt: O74754
Position
II:join(1085936..1086015,1086095..1086920)
AA seq 301 aa
MLRQTLTQASRMRPCISVVGFRGFHASSPCEATLKEIEQRLKSIKNIEKITKTIKTVAQT
KLTRAQRAMEASNKYYRVSDEVFKEAGTKAPEEGKTLMVACSSDKGLCGGIHSSISRLIR
RELHDPKTFENTSLCILGEKVRTQLLRFCPESFYLTFAHIGGASPSFEEALQISSNILEH
AKDYDRIVLVYNKFASAVSFETVMKNLYTTKAINESPNLSAYEVSDEVHQPLMEFAFANA
IFSAMAEAHCSEMSSRRNAMENASKSAGDMINKFSIQYNRQRQASITNELIDIVTGANSL
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcttcgtcaaacgctaactcaggcgtctcggatgcgtccttgtatatctgtagttgga
tttcggggttttcacgctagttctccttgtgaggcaacgctaaaagagattgaacaaagg
ctgaagtctattaagaacattgaaaagattaccaagaccatcaaaactgtagctcaaact
aagcttactagggctcaacgtgctatggaagcttctaacaaatactatcgtgtatctgat
gaagtgtttaaggaggctggaactaaagcacctgaggagggtaaaactcttatggttgct
tgctctagtgacaagggtctttgtggtggtattcattcttcaatctctcgtcttatccgt
agagaactacatgatcctaagacatttgagaacacaagtttgtgtattttgggagaaaaa
gttcgcactcaattacttcgtttctgtcccgaatctttctacttgacttttgcacacatt
ggtggagctagtccttcttttgaagaagctttacaaatttctagtaacattttggaacat
gctaaagactatgatagaattgttctcgtctataacaagtttgcttccgctgtctcgttt
gaaactgtgatgaagaacttgtatacaactaaggccatcaatgaatcccccaatctctct
gcatacgaggtaagtgatgaagtccatcaaccactcatggaatttgcatttgccaatgct
attttttctgccatggcggaagctcattgcagtgaaatgtcatctcgtcgtaacgccatg
gaaaatgcaagcaagagtgctggagatatgattaacaagttttccatccaatataatcgt
caacgtcaagcctccattactaacgaacttatcgatatcgttactggtgcaaactctttg
gcttaa

DBGET integrated database retrieval system