KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1734.14c
Entry
SPBC1734.14c      CDS       T00076                                 

Gene name
suc1
Definition
(RefSeq) cyclin-dependent protein kinase regulatory subunit Suc1
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBC1734.14c (suc1)
SSDB
Motif
Pfam: CKS
Other DBs
NCBI-GeneID: 2540027
NCBI-ProteinID: NP_595431
PomBase: SPBC1734.14c
UniProt: P08463
Structure
PDB: 
1PUC 1SCE

Position
II:complement(join(1088271..1088378,1088430..1088574,1088690..1088778))
AA seq 113 aa
MSKSGVPRLLTASERERLEPFIDQIHYSPRYADDEYEYRHVMLPKAMLKAIPTDYFNPET
GTLRILQEEEWRGLGITQSLGWEMYEVHVPEPHILLFKREKDYQMKFSQQRGG
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtcgaaaagtggtgtgccacgtcttttaactgcttctgagcgtgaacgtctagagcca
ttcattgatcaaatccattattctcctagatatgctgatgatgaatatgaatatcgacat
gttatgttaccaaaagcaatgctaaaagcgatacccaccgattatttcaatccagagact
ggaacgcttcgaatccttcaagaagaagaatggagaggacttggaattactcaaagtctg
ggatgggaaatgtatgaagtccatgtcccagagccacacatcctgctatttaagcgtgaa
aaagattatcaaatgaaatttagtcaacaacggggtggttaa

DBGET integrated database retrieval system