KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1773.14
Entry
SPBC1773.14       CDS       T00076                                 
Symbol
arg7
Name
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00220  Arginine biosynthesis
spo00250  Alanine, aspartate and glutamate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC1773.14 (arg7)
   00220 Arginine biosynthesis
    SPBC1773.14 (arg7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC1773.14 (arg7)
Enzymes [BR:spo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     SPBC1773.14 (arg7)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC1773.14 (arg7)
SSDB
Motif
Pfam: Lyase_1 ASL_C2
Other DBs
NCBI-GeneID: 2539980
NCBI-ProteinID: NP_595129
PomBase: SPBC1773.14
UniProt: P40369
Position
II:313297..314682
AA seq 461 aa
MAEKSSKKLWGGRFSGATDPLMAEFNKSIYSGKEMCEEDVIGSMAYAKALCQKNVISEEE
LNSILKGLEQIQREWNSGQFVLEPSDEDVHTANERRLTEIIGDVAGKLHTGRSRNDQVTT
DLRLWLCRKIKEVEVYVINLLKVFTNRAEMEIDVIMSGYTHLQRAQPVRWSHFLMSHALP
LLGDLGRLRQLYTRVSQLPLGAGALAGNPFNVDREFLRKELGFEGIIMNSMNAVGDRDFV
IEFMFWAGMVMLHISRFAEDLIIYSSSEFGFVTLSDAYSTGSSIMPQKKNPDSLELLRGK
SGRVLGDMIGLMITVKGTPTTYNKDLQEDKEPLFDAFKTVSDSLQILTGVVSTLTINPTK
IAESLTPDLLATDLAEYLVRKGLPFRQTHHISGSAVRMAEERNTTLDKLSVSDLQSLHPL
FDEDVSKVFNYEESVEKRCSIGGTAKHCVQEQIEHIRSAIL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggcagaaaaatcaagcaaaaaactatggggaggtagattttcaggagctactgatcca
ctgatggcagaattcaacaaatccatctatagtggaaaggaaatgtgcgaagaagatgtt
attggttccatggcgtacgcaaaagccttgtgccagaaaaatgtgatatctgaagaagag
ctgaatagcatcctaaaaggattggaacaaattcaaagagaatggaattcgggtcaattc
gttttggaaccatccgacgaagatgttcacacagcaaacgagcgccgattaactgagata
atcggtgatgttgctggcaagctacatactggcagaagtcgtaatgaccaagttaccacc
gatttgcgtttatggctatgcagaaaaatcaaagaggttgaagtctatgtcattaacttg
cttaaagtttttaccaacagagctgagatggagattgatgtaataatgtcaggttatacg
catttacaaagggctcagcctgttcgttggtcccattttctcatgtctcacgccttgcct
ttattaggtgaccttggcagacttcgtcagctgtatactcgtgtaagtcaattaccgctg
ggtgctggtgctttagctggcaaccctttcaacgtcgatcgcgagttccttcgtaaagag
cttggattcgaaggcattatcatgaattccatgaatgctgttggtgatcgtgattttgtc
atcgaatttatgttttgggcaggcatggtaatgcttcacatttctcgctttgctgaagat
cttatcatatattcgagctcggaatttggattcgtcacactctccgatgcgtattctacg
ggaagtagtattatgccccaaaaaaagaaccctgattctttagagctacttcggggtaag
agcggtcgtgttttaggtgatatgattggcctcatgataactgttaaaggcacacctaca
acctataacaaagatttgcaagaagacaaggaaccactatttgatgcctttaagaccgtc
tctgactctttgcaaattttgactggcgttgtctcaacccttaccatcaatcctacaaag
attgccgaaagcttgacccccgatttactagctaccgatttggctgagtatcttgttcgt
aaaggtcttccatttcgccaaactcatcatatttcgggatccgcagttcgcatggctgaa
gagagaaacactactctcgacaagttatcagtttctgatttgcaatcattgcatccttta
tttgatgaagacgtttcaaaagtctttaattacgaagaaagtgttgaaaaaagatgttca
attggtggtactgctaagcattgtgttcaagaacaaatcgagcatatacgatcagcaatt
ctttaa

DBGET integrated database retrieval system