KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1778.02Help
Entry
SPBC1778.02       CDS       T00076                                 

Gene name
rap1
Definition
(RefSeq) telomere-binding protein Rap1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rap1-DNA-bind Myb_DNA-bind_2 BRCT_2 Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 2540115
NCBI-ProteinID: NP_596285
PomBase: SPBC1778.02
UniProt: Q96TL7
Structure
PDB: 

Position
II:join(3098366..3098461,3098508..3098879,3098963..3100576)
Genome map
AA seq 693 aa AA seqDB search
MSFTFTKSDGSSILFAVSKNFEHIRGFKNAIDCFKGKIEFLSFDKVDPTKHDYYLVAEDE
RVSDLDIPKGFFERNPEFRHKMLKIAWITQCIEQGKLLPTESFEVELNQDDVNRTHDGFR
KRELFTLEDEKILIDHVHKNDINRFGTKVYEELARKYPQHSLESWRQHYKYMKKRLPPVS
DSDESNYCQRIIVKPYSSQKDYTQSTHEQTLSSPISKSASVSKSENKALVNNKRYSDSYF
YFSKMRRISIDVDYVDEDLNLINAYLSQFGKKRSLNELCALLSRRFSNRHTFSEWRALFM
HFFPFINSEGVDPAILSDRETSAMLDETSDNEVADIDDQMIERKYLFSASEPNTVKSTNR
LIFSERKAYAADDSIDNTPSKVPIVNSLSDPRTNRPFFYSNPDSMYRSISNPLHLVDSQH
LSPLNRKTHFNNPIGQPQFTCLDDHEKTLRETSFRSLDDMSLRKSNSDNIFVKPGEDLEI
PLLSDYSDSENISEKSSDDEEAFEKQVTSSYSSPIKVKSQGKSSKGSSGLDVREHEGSDD
DAEVFVDRSPESFGATKVAHTSLEGNAASHKKVEENMQQPVTKKQKKYRMVNEEAHTGPT
IIIPSDNNEKVTTLPAGHVPSEEKGKFINLAMHELQNEVSILRSSVNHREVDEAIDNILR
YTNSTEQQFLEAMESTGGRVRIAIAKLLSKQTS
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacattcaccaaaagcgatggctcgtccattttatttgcagtgtcaaaaaac
tttgaacatattaggggattcaaaaatgcaattgattgttttaaaggaaaaattgaattt
ttaagttttgataaagttgaccctactaaacacgattattacttagtcgcagaagatgaa
cgcgtctcggacttagatattcccaagggatttttcgagcgtaatccagaatttcgacat
aaaatgttaaaaattgcgtggattactcagtgtattgaacaaggaaaacttttgcctacg
gaatccttcgaagtagaattaaatcaagacgacgtaaatcgtacccatgatgggtttaga
aagagagaactgttcactttagaagatgaaaaaattcttattgaccatgtgcataagaat
gatataaaccgctttggtacaaaggtttatgaggaactcgccagaaagtatcctcaacat
tctcttgaatcctggcggcaacattataagtacatgaaaaaacgcttaccacctgtatct
gattccgatgaatctaattattgccaaaggataattgtaaagccttactcgtcccaaaag
gattatacacaaagcacacatgaacaaactctatcatccccgatttccaagtctgcttcg
gtttcaaaaagcgaaaataaagctttagtgaataataaaaggtattctgacagttacttc
tatttttctaagatgagacgcatttcgatagatgttgattatgtagatgaggacctaaac
ttaatcaatgcatacttatcccaatttggaaaaaagagaagtctaaacgaattgtgtgct
ctgttgagtagaaggttttctaaccgacatacattttccgaatggagggcgctttttatg
catttttttccttttataaattctgaaggagttgatcctgctattttatcagatagagaa
acatctgcaatgcttgatgaaacttcggataatgaggttgctgatattgacgaccaaatg
atagaaaggaaatatttatttagtgcttctgaaccgaatactgtcaaatctaccaatcga
ttgatattctctgaaaggaaagcatatgcagctgatgactcgattgataatacaccttcg
aaagtacccattgttaatagcttaagtgatccgcgaaccaatagacctttcttttattca
aacccagacagcatgtaccgctctatatctaatcccttacacttggttgattctcaacat
ttatctccattaaatcgaaaaactcattttaacaatcctattggtcaaccccaatttact
tgtctcgatgatcacgaaaaaaccttgcgtgaaacttcatttagatcgcttgatgacatg
agtttaagaaaatccaattctgataatattttcgtcaaacctggtgaagacctcgagatt
cctttgctgagtgactatagtgatagtgaaaacatttcagaaaagtcttcagatgatgaa
gaggcttttgagaaacaagtgacatcaagttactcttcacctataaaagtaaaatcccaa
ggaaaaagctctaaagggtcatcaggattagatgtgcgtgaacatgaaggctccgacgat
gacgccgaggtttttgttgatcggtctccagaaagctttggtgccacaaaagtcgctcac
acttcgttagaaggaaatgcagcttctcataagaaagtggaagagaacatgcagcaaccg
gttaccaaaaagcagaaaaaatacagaatggttaacgaagaagctcataccggtccgact
ataatcataccgtcagataataatgaaaaagtaactacattacctgcaggtcatgtaccc
agtgaagagaaaggaaaatttattaacttagcaatgcatgaattacaaaatgaagtttct
attttaaggtcgtcagtaaatcaccgtgaggttgatgaagcgatcgacaatattttaagg
tacacaaattcaacagaacaacaattccttgaagctatggaatctacgggtggaagagta
cgaattgccattgctaaactactttcaaaacaaacttcttaa

DBGET integrated database retrieval system