KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1778.06c
Entry
SPBC1778.06c      CDS       T00076                                 

Gene name
fim1
Definition
(RefSeq) fimbrin
  KO
K17275  plastin-1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPBC1778.06c (fim1)
   04147 Exosome [BR:spo04147]
    SPBC1778.06c (fim1)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     SPBC1778.06c (fim1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   SPBC1778.06c (fim1)
SSDB
Motif
Pfam: CH EF-hand_1 CAMSAP_CH EF-hand_7 EF-hand_6 DUF1463
Other DBs
NCBI-GeneID: 2539765
NCBI-ProteinID: NP_596289
PomBase: SPBC1778.06c
UniProt: O59945
Structure
PDB: 
1RT8

Position
II:complement(join(3106767..3106888,3106943..3108431,3108508..3108741))
AA seq 614 aa
MLALKLQKKYPELTNEEILTLTDQFNKLDVDGKGYLDQPTTIKAFEDSKKGSYDEVREAI
REVNVDSSGRVEPEDFVGIFNVLKKGVEGTEVKKGRITIKGSSSSVSHTINEEERREFIK
HINSVLAGDPDVGSRVPINTETFEFFDQCKDGLILSKLINDSVPDTIDERVLNKQRNNKP
LDNFKCIENNNVVINSAKAMGGISITNIGAGDILEGREHLILGLVWQIIRRGLLGKIDIT
LHPELYRLLEEDETLDQFLRLPPEKILLRWFNYHLKAANWPRTVSNFSKDVSDGENYTVL
LNQLAPELCSRAPLQTTDVLQRAEQVLQNAEKLDCRKYLTPTAMVAGNPKLNLAFVAHLF
NTHPGLEPLNEEEKPEIEPFDAEGEREARVFTLWLNSLDVTPSIHDFFNNLRDGLILLQA
YDKITPNTVNWKKVNKAPASGDEMMRFKAVENCNYAVDLGKNQGFSLVGIQGADITDGSR
TLTLALVWQMMRMNITKTLHSLSRGGKTLSDSDMVAWANSMAAKGGKGSQIRSFRDPSIS
TGVFVLDVLHGIKSEYVDYNLVTDGSTEELAIQNARLAISIARKLGAVIFILPEDIVAVR
PRLVLHFIGSLMAV
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgttagctcttaaacttcaaaagaagtatccggagctcactaatgaggaaattctaacc
ttaaccgaccaatttaacaaacttgatgtggatggaaagggatatttagatcaacctacc
actattaaagcctttgaagattcaaagaagggttcttacgatgaggtccgtgaagcaatt
cgtgaagttaacgttgattcgtctggacgtgttgaacccgaagactttgtaggaattttc
aatgttttaaaaaaaggtgtagaaggtactgaagtaaaaaagggtcggattactatcaaa
ggatcttcctcaagtgtttctcataccattaatgaggaagagcgaagagaatttatcaag
catattaattccgtcttagctggagaccctgatgttggttcccgagtccccatcaacact
gaaacctttgagtttttcgatcaatgcaaagatggtttaatcctctcaaagttaattaat
gacagcgttcccgacaccattgatgagcgtgtactcaataaacagagaaataacaagcct
cttgataatttcaaatgtattgaaaataacaatgttgttattaactccgcaaaagctatg
ggtggtatctccattaccaacattggtgccggcgatattttagaaggtcgtgaacatttg
attcttggtcttgtttggcaaatcattcgccgcggtctccttggaaagattgatattact
ttacatcccgagctttaccgccttctcgaagaggatgaaacccttgaccaatttctccgt
ctccctcctgagaaaattcttctccgctggttcaattatcacttaaaggctgccaattgg
ccgcgtactgtctctaacttctcaaaagatgtttcagatggcgagaattatactgtgctg
ctcaaccaattagctcccgaactctgttcacgtgctcctcttcaaactacagatgttttg
cagcgtgctgaacaggttttacagaatgctgaaaaattggattgccgcaaatatcttaca
cctaccgctatggttgcagggaaccctaagcttaaccttgcctttgttgctcatctcttt
aatactcatccaggtttggagcctttaaatgaagaggaaaagccggagattgaaccattt
gatgcagaaggtgagcgtgaggcacgtgtttttaccttgtggttgaactctcttgatgtt
actccatccattcatgacttcttcaataatttacgagatggcttgattttgttgcaagct
tacgataaaatcacacctaataccgttaactggaaaaaggtgaacaaggcacctgcatct
ggagatgaaatgatgcgtttcaaagctgttgaaaactgtaattatgcagtggaccttgga
aaaaatcaaggtttttctttggtaggaatacaaggtgctgatattactgacggttctcgt
acactcaccttagcattggtttggcaaatgatgcgtatgaacattaccaaaactctacat
agtcttagccgtggaggtaaaactctttcagatagtgacatggttgcgtgggccaattct
atggctgctaaaggtggtaaaggttctcaaattcgttcattccgtgatccttctatttcc
actggtgtgttcgtcttagacgtacttcatggaattaagagcgaatatgttgattacaat
cttgttaccgatggttctactgaagaacttgctattcaaaatgctcgtcttgctatttct
atcgccagaaagttgggtgccgtaatctttattttgccagaagatattgtggccgttcgt
cctcggttggtccttcattttattggcagtttaatggccgtataa

DBGET integrated database retrieval system