KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17A3.04cHelp
Entry
SPBC17A3.04c      CDS       T00076                                 

Gene name
rar1
Definition
(RefSeq) putative methionine--tRNA (Met) ligase Mrs1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00450  Selenocompound metabolism
spo00970  Aminoacyl-tRNA biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPBC17A3.04c (rar1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPBC17A3.04c (rar1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC17A3.04c (rar1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC17A3.04c (rar1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPBC17A3.04c (rar1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPBC17A3.04c (rar1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPBC17A3.04c (rar1)
 Prokaryotic type
   Other AARSs
    SPBC17A3.04c (rar1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 2540052
NCBI-ProteinID: NP_595586
PomBase: SPBC17A3.04c
UniProt: Q9UUF2
Position
II:complement(join(1407408..1409559,1409621..1409699,1409766..1409883))
Genome map
AA seq 782 aa AA seqDB search
MATYKVQIPASFKTSYSFAESLKVSIAISAFSVKVPCEGAANCNSVRLVNSKEPEKYVSD
ANAIVSFLYWKQEEDLFNSFISSKLSILDWEALQFTPKAYTAKTKEDFAYLLSQLETIFK
ENEILNEFTPVEVALASDIYFCVLNGAPVREYPLLSAWYLKIEKQKPFVQALKLTFEKTL
GQPAVTSTEKIPVSETTRNVNSQHLMRERVPGEKILPKSNERNILITSALPYVNNVPHLG
NIVGSTLSADVFARYHRARNHNTLYICGTDEYGTATETKALEEGVSPKELCDKYHALHKE
VYDWFEIDFDHFGRTTTPKQTGIAQHIFTKLYNNDYMAIDTMTQLYCEVHQGYLADRYVE
GTCPKCGYDDARGDQCDGCGGLLNAFELIDPKCKLDRATPVKRETKHVFLSLDKLQPAVE
SWAMQSAVEGKWSNNGRSITESWLKEGLRPRCITRDLKWGTPVPLEEFKGKVLYVWFDAT
IGYISITANYTDEWEKWWRNPEQVKLYQFMGKDNVPFHTVIFPSSLLGTGEKWTMLHHIN
TTDYLNYETGKFSKSRGVGVFGNTAQDIGLSPSVWRYYLLSSRPETSDTMFTWKEFITRH
NSELLANLGNFVNRTLKFTTAKYNGLVPHYLTDPSVGAGKLKADFVKDVNALLAKYNAAL
EASKLREGLRLAMEISARGNQYLQDNRIDNKCYLYERQKCADAIGYALNLIYLLAAIFYP
YMPSTSTSIYKQLNAPAAAIPDTWELCLLPGHRIGEPEYLFTRIDESMEEEWRSKYGGNG
SN
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctataaagttcaaatcccagcgtctttcaagacgtcttatagttttgctgag
tcattaaaagtttctattgccatttctgctttctctgtcaaggtaccttgtgagggagct
gcaaactgcaattctgtacgtttagtaaattcaaaggaacctgaaaaatatgtttcggat
gcaaatgcgatagtcagttttttgtattggaaacaggaagaagatttgttcaattccttt
atttcttctaaacttagtattttggattgggaagcccttcagtttacccctaaggcgtat
actgcaaagacaaaggaagactttgcttatttgctttctcagttagaaacaattttcaaa
gaaaatgaaatattgaatgaatttactcctgtagaagtagcgcttgcttccgatatctat
ttttgtgttctgaatggtgctcccgtccgtgaatatccactccttagcgcttggtatctt
aaaatcgaaaagcaaaaaccctttgttcaggccttaaagttgacttttgaaaaaacattg
gggcaacctgccgtaacatcaacggaaaaaattcctgtgtctgaaactactcgcaatgtc
aattcccaacacttaatgcgtgagcgagttcctggtgagaagattcttcccaagtctaat
gaaaggaatattttgattacttctgccttaccatatgtcaacaacgtacctcatttggga
aacattgttggtagtactcttagcgccgacgtttttgcccgttatcatcgcgctcgtaac
cacaatactctttatatttgcggtactgatgagtatggtacagccactgaaaccaaagcg
ttagaggaaggcgtgtctcctaaagagctttgtgataagtatcacgcattacataaggag
gtttacgactggtttgagattgactttgatcactttggtcgtactactactcccaaacaa
actggaattgctcaacatattttcacaaagctgtacaacaatgattacatggctatagat
accatgactcagctgtactgcgaggtccatcaaggataccttgccgacagatatgtcgag
ggaacttgtcccaaatgtggctatgatgatgccagaggtgatcaatgtgatggttgcggt
ggacttttgaacgcttttgagcttattgatcctaagtgcaaactggatcgtgcaacaccc
gttaaacgtgagactaagcacgttttcttatcgttggataaacttcaacctgccgttgag
tcatgggctatgcagtcggctgttgaagggaaatggtccaacaacggtcgctccatcact
gagtcatggttaaaggaaggattgcgtccacgttgtattactagagatctgaaatggggt
actcctgttcctttggaggaatttaaaggaaaggtattgtatgtttggtttgatgcaaca
attggatatattagtattaccgccaattatacagacgaatgggagaagtggtggagaaac
cctgagcaagtcaaactttatcagtttatgggtaaagataatgttccattccatactgtt
attttcccttcctctcttttgggtactggcgagaaatggaccatgttgcatcatatcaat
actactgattatttgaattatgagactggtaaattttcgaagtcaagaggggttggtgtg
ttcggtaataccgctcaagacattggtctttctccttctgtttggcgctattatcttttg
tcatctcgccctgaaacctcggatacaatgtttacatggaaggaatttattactaggcat
aactccgagcttttagctaatctcggtaactttgtgaatcgtacacttaaattcactacc
gccaaatacaatggtctcgtccctcattatctaactgatccttccgttggtgctggcaag
ctcaaggccgatttcgttaaagacgttaacgctcttttagccaagtacaatgccgcactt
gaggcctctaagttacgtgaaggcttacgtcttgccatggaaatatcagctcgtggtaac
caatacttacaagacaatcgtatcgacaacaagtgctatctctatgagcgccaaaagtgt
gctgatgcaattggttatgccttgaacttgatttatcttcttgctgccattttctatcct
tatatgcctagtaccagtaccagcatttacaagcaactgaatgctcctgcagctgctatt
cccgatacttgggagctttgcttacttcctggacatagaattggcgagcctgagtactta
tttacccgcattgatgagtccatggaagaagaatggcgcagcaaatatggtggtaatgga
tcaaactaa

DBGET integrated database retrieval system