KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17A3.08Help
Entry
SPBC17A3.08       CDS       T00076                                 

Definition
(RefSeq) deoxyribonuclease Tat-D
  KO
K03424  TatD DNase family protein [EC:3.1.21.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPBC17A3.08
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     SPBC17A3.08
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase Hydrolase
Motif
Other DBs
NCBI-GeneID: 2539901
NCBI-ProteinID: NP_595590
PomBase: SPBC17A3.08
UniProt: Q9UUF1
Position
II:join(1416265..1416296,1416351..1416544,1416720..1416918,1416984..1417261,1417325..1417560)
Genome map
AA seq 312 aa AA seqDB search
MASIRQAFVKSLRFYDIGYNATDPVFRGIYHEKLKHPDDFDSIISRAKAVGVEKMMITGD
NVENSEEALNLATNYECFTSTVGVHPCQAQCFLRHSEGPEDYLVKLEALANKGKASGKVV
AFGEFGLDYDRLHYAPADVQKMYFEEQLKVAVRVQLPLFLHSRNAENDFFAILEKYLPEL
PKKGVVHSFTGSIDEMRRCIEHGLYVGVNGCSLKTEENLEVVRAIPLEKMLLETDAPWCE
VRPSHAGHQFLKTKLPFDSCKKERFKEGCMIRGRNEPCNTYIVAEIVAALKDISLEELSE
QIWENSINLLSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaattaggcaagcatttgtaaaaagtttgcgattttatgacattggatacaac
gcaacagatcctgtttttcgaggtatttatcatgaaaaactaaaacatcctgatgatttt
gattccataatttctcgagcgaaagctgtgggagtagaaaaaatgatgattaccggcgac
aatgtcgaaaactctgaagaagccctgaatttagctacaaactatgaatgtttcactagt
accgtgggcgtgcatccatgtcaggcacaatgctttctaaggcactctgagggtcctgaa
gattatctagtaaaactagaagcattggctaataagggcaaagcttcaggaaaagtagtt
gcttttggtgaatttggtcttgattatgatagattacattatgcgcctgctgatgttcaa
aagatgtattttgaagaacaattaaaagttgctgttcgagtccagttaccactttttctg
cattctagaaatgctgagaatgatttttttgctatcctagaaaagtatcttccagaatta
cccaaaaaaggagtagtacattcttttacagggagtatagatgagatgaggcgttgtatt
gaacacggcttgtacgttggagttaacggttgttccttaaaaacggaagaaaatcttgag
gtggttcgagcaattcctcttgaaaaaatgcttttggagacagatgccccatggtgtgaa
gtacgaccatctcatgcaggacatcagtttttgaaaacaaaattgccatttgattcatgt
aaaaaagaaaggtttaaggagggatgcatgattcgtgggagaaatgaaccctgtaacact
tatatagtcgcagagattgtagcggcgctgaaagatatatcgttagaagaattatcagaa
caaatttgggaaaacagtattaatcttttatctaaatag

DBGET integrated database retrieval system