KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17D1.06
Entry
SPBC17D1.06       CDS       T00076                                 

Gene name
dbp3
Definition
(RefSeq) putative ATP-dependent RNA helicase Dbp3
  KO
K14811  ATP-dependent RNA helicase DBP3 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC17D1.06 (dbp3)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPBC17D1.06 (dbp3)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    SPBC17D1.06 (dbp3)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C CMS1 AAA_22 MAP17 Presenilin Zip
Other DBs
NCBI-GeneID: 2540213
NCBI-ProteinID: NP_596388
PomBase: SPBC17D1.06
UniProt: Q10202
Position
II:3338604..3340340
AA seq 578 aa
MQFCFRILILYISLSIDNNYLVTTLISLKENVFLHIFTLTFLFKAFLLKMAKRSVEELKR
SADEEASVKRKEKKSKHEHKKHKKDKPSADKDRISKKDKKKSKKGKSKTKEESIEINAEE
GAKIAQPAIGSANASNHNDEEAYDRYIKKHNISFADPKSSENLLPILQFDELDVSAKLRE
GLKNYKEPTPIQAATWPYLLAGRDVVGIAETGSGKTVAFGIPALQYLNGLSDNKSVPRVL
VVSPTRELAIQTYENLNSLIQGTNLKAVVVYGGAPKSEQARAAKNASVIIGTPGRLLDLI
NDGSIDCSQVGYLVLDEADRMLDTGFEQDIRNIISHTPDPTRNGSRQTVFFSATWPESVR
ALAATFLKDPVKITIGSDELAASQNITQIVEILDDPRSKERMLDNLLRKHLSSGGKDDKI
LIFVLYKKEAARVEGTLARKYNVVGIHGDMSQGARLQALNDFKSGKCPVLVATDVAARGL
DIPKVQLVINVTFPLTIEDYVHRIGRTGRANTKGTAITFFTPQDKSHAGELVNVLRQAKQ
DIPEGLFKFGTAVKPKLNAYGSRVVDVPVKAATKIVFD
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgcaattttgttttaggattttaatattgtatatatcgttaagcatagataacaattac
ttggttactacgttaatatctctgaaggaaaatgtttttttgcatatttttactctaacc
tttctcttcaaagctttccttttaaaaatggcgaaacgatcagtggaagagttaaaaaga
tcggcggatgaagaagcttctgttaagcgaaaggagaagaaatcaaagcatgagcataag
aagcataaaaaagataagccctctgccgacaaggatagaatttcaaaaaaggataaaaag
aaatcaaagaaaggaaaatcaaaaactaaagaagaatcgatagaaatcaatgcggaagag
ggagcaaaaatcgcacaacccgcgatcggctcagctaacgcttctaatcataatgatgaa
gaagcgtatgaccgttacattaagaagcataatatttcttttgcggatcctaaatcctct
gaaaatttacttccaattcttcagttcgatgaactagacgtttcagctaagttacgcgag
ggtttaaagaattataaggaacctacgcctattcaagctgctacttggccttatttacta
gctgggagagacgtggtaggaattgctgaaaccggttctggtaagactgttgcattcgga
attcctgctttgcaatacctcaatggtttgtcagataacaagtctgtccctcgtgttttg
gtagttagtcctactcgagaattagccattcaaacgtatgaaaacctcaatagtcttatt
caaggtaccaacttaaaagctgtggttgtttatggcggcgcccctaaatcggagcaagcg
agggctgccaagaacgccagtgtcattattggtacccctggtcgtttgttggatctgatt
aacgatggctcgattgattgttctcaagttggttaccttgttttagatgaggcagatcgt
atgcttgacactggattcgaacaagatatccgtaacatcatcagccataccccagatccc
actcgtaatggatccagacaaactgtctttttcagtgctacttggcctgaatccgttcgc
gctcttgctgctacctttttaaaggatcccgttaaaatcactattggaagtgatgaacta
gctgcttcccaaaatatcacacagattgttgaaattctggatgacccaagaagcaaggag
agaatgcttgataatcttctcagaaagcatctttcttctggagggaaagacgataaaatc
ctcatatttgttttgtacaaaaaagaagcagctagagttgaaggtaccttggctaggaaa
tataacgtggtgggcattcatggtgatatgtcccagggagcccgattacaagcattaaat
gactttaagtctggaaaatgtcccgtactagtagcaactgacgttgccgcccgaggtttg
gacattcctaaagtgcaacttgtgattaatgttactttccccttgactatagaagattat
gttcatagaatcggacgtactggccgtgccaacacaaaaggtactgctattacatttttc
actccacaagacaagtcacatgctggtgagcttgttaatgttcttcgtcaagccaaacaa
gatattcctgaaggactattcaagtttggaacagctgtcaagcccaaacttaatgcttac
ggaagtcgtgtagtcgacgttcctgtaaaggctgctactaagattgtttttgactaa

DBGET integrated database retrieval system