KEGG   Schizosaccharomyces pombe (fission yeast): SPBC17G9.13c
Entry
SPBC17G9.13c      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Complex1_LYR
Other DBs
NCBI-GeneID: 2539657
NCBI-ProteinID: NP_595902
PomBase: SPBC17G9.13c
UniProt: Q9UUD9
Position
II:complement(2196584..2197537)
AA seq 317 aa
MRFISTVTKRRPFQAPNDLVHPLSNILGSLVTYDSRLHLPQPKDRQCSTLVPLYRRLLKA
TRRFWDPMASQILISHFQAYARKARKSNPNPHKRRIKRFRNLLKTFACRIERANDGDHQA
IWQTLRYAYSQTGPLRHRRLHYLQDNKIRPSKIPKSLPSNSPVRLPYISSLLSAVFEINM
ENAKIRHLPSVIFDGLIEKNKDRPYHINLSCKRAYDELLPRIAVPLLPHEYHHLHSLLLD
VTLRNPQISRPPFAPLNPRKGFCRILQRSLITFLSAVCYLPYNPHPTSKPVVSWDSLSDI
QLRLNVGKVLKKSVKKR
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagatttatttctacagttaccaaaaggagaccattccaagctccaaatgatcttgtt
catccactttcgaacattttaggtagcctggtaacttatgactctcgtttacacttacct
caaccaaaggacaggcagtgctcgactctagtccctctttatcgaagactattaaaggca
actcgaagattctgggatccaatggcatcccaaatcctaatctcacattttcaagcttac
gcccgaaaagctcgcaagtcaaatcctaatcctcacaagcggcgcataaaacggtttcgc
aatctcctaaaaacttttgcatgtcgtattgagcgcgccaatgatggcgaccatcaagct
atatggcagactttacgatacgcttattcacaaacaggtcctcttcgtcataggcgtctt
cattatttacaagataataaaattcgaccttcaaagatacccaaaagtttaccatctaat
tcaccagttcgtcttccttacatttcatccctattatcggccgtttttgagataaatatg
gaaaatgcaaaaatccgccatttgcccagcgtcatatttgacggtttaatagagaaaaac
aaagatcgcccttaccatattaaccttagttgcaagagggcatacgacgaacttttgcct
cgtattgctgtcccactcttaccacatgaatatcatcacttgcattcacttctcttagat
gtcacacttcgaaatccacaaatttcgcgaccaccgtttgcaccactgaaccccagaaag
gggttctgtcgtatcttacagagatcgctcataacctttttgagtgccgtttgctatttg
ccttataatcctcaccctacctccaaacctgttgtatcgtgggactctttgtcagacatt
cagctcaggctaaacgtcggaaaggttcttaaaaagtcagtcaaaaaaaggtag

DBGET integrated database retrieval system