KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1861.05
Entry
SPBC1861.05       CDS       T00076                                 

Name
(RefSeq) putative carbohydrate kinase
  KO
K16330  pseudouridylate synthase / pseudouridine kinase [EC:4.2.1.70 2.7.1.83]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00240  Pyrimidine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPBC1861.05
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.83  pseudouridine kinase
     SPBC1861.05
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.70  pseudouridylate synthase
     SPBC1861.05
SSDB
Motif
Pfam: Indigoidine_A PfkB Phos_pyr_kin
Other DBs
NCBI-GeneID: 2539763
NCBI-ProteinID: NP_596722
PomBase: SPBC1861.05
UniProt: Q9USY1
Position
II:4140551..4142794
AA seq 747 aa
MLIVMNRGCRLVSRIPLGFRRLKRNPNPGLRNILCRRYSPLALSKEVTEALKNNVPVVAL
ESTIITHGMPYPQNEELAIQVESKVRSMGAVPATIALLNGQCTIGLEQFQLSELAKSGET
AYKVSRRDLSYVASQRLNGGTTVAATMILARAAGIDVFATGGIGGVHRGAENSMDISADL
IELGRTRVAVVSAGVKSILDIGRTLEVLETQGVPVVTLGPPKSAFPAFFSRESKFQSPLS
LETPQLIANMLFSNIQLGQECGTLVAIPTPHHCSIDYEKMEALIETCLQRSVQLGITGKN
VTPWLLGELLRESKGKSLNTNIDLVLNNAEKASLIAKELAVLKEKSSFFPTNTGNTFETK
PVKQDFFYGKVSDKGVSSSKKKITETTSKPAEVVCVGSVSIDSVLKLDNPLTSKFLGTSH
PCHSEQAFGGVAHNMALASSLMGASTKLVSCVGTKSVPTSSIKEYLTKSSLQHTIVEKSN
FTSCSYTAINDCNGNLLLAGADMAIMENLSYSEIKDDLNDAKYICFDGNISPSLMLDITT
SKSSKQRVVFEPTSGPKTLKILKVLSVASIDFITPNKFELDVLFQAMKDGNFFENESWWQ
KLNSFGITSSFYNEIERFTKSTGIEEITENGILQKCFHLLPFIKNIIVKLGPNGALLISS
EKLQGVNSNSASLFTPGNVTVKYYPVPKVIATPVNASGTGDTFIGTFTALLSKGWGMDDA
IDTAQKAAGLTLQCNFSVNPEIKTLLK
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgctcatcgttatgaatagaggttgtcggttagtttcacgtattccattggggttcaga
aggctgaagagaaatccaaaccctggattgaggaatatactttgcagaagatatagtccg
ctggccttatccaaggaagtgacagaagcccttaaaaacaacgtaccagtcgttgcctta
gaatcaactatcatcactcatggaatgccttatcctcaaaatgaagaattggcaattcaa
gtggaaagcaaggtacgcagcatgggtgcggttcctgcgacaattgctctattaaatgga
caatgtactatagggcttgaacaatttcagttaagcgaacttgctaaatcaggtgaaaca
gcatataaagtgtctcgtagagatttatcttatgttgcttcccagagactcaatggtgga
accacagttgctgcaactatgatcttggctagagcagctggcattgacgtattcgcaacg
ggcggtataggtggtgttcatcgtggggcagaaaattccatggatatttctgcggattta
atagaattaggtcgcacaagggttgccgtcgtcagtgctggtgtcaagagtatactcgat
attggacgcacacttgaagtattagaaactcagggtgttcctgttgtcactttaggccct
ccaaaatcggctttccctgcatttttttcaagagaatccaagttccagagccctctttct
ctagaaactccgcagttaattgctaacatgctctttagtaatatacagcttggccaggaa
tgtggtactcttgtggccattcccacccctcaccattgttctattgattacgaaaaaatg
gaggctttgattgaaacttgtttgcaaaggagtgtacaacttggcataactggtaaaaat
gtaactccatggcttttaggagaacttctaagagaatcaaaagggaaaagtttaaatact
aatattgatttggtcttaaacaatgccgaaaaggcttcccttattgcaaaagaactagct
gttttaaaagaaaaaagctcttttttccctaccaacaccggaaatacatttgaaacgaag
ccggttaaacaagactttttctatggtaaagtgagtgacaaaggggtttcgtcgagcaaa
aaaaaaattacagaaacaacgtccaaacctgcagaagttgtatgtgttggtagtgtgtct
attgactcagttttgaaattggataatcctttaacatctaaattccttggcacatctcat
ccttgtcactctgaacaggcttttggcggtgttgctcataacatggctttggcttcttct
ttaatgggcgcttctacgaagttggtttcatgtgttggaacaaaatccgtacccacttcc
tctattaaagagtatcttaccaagtcttctttgcagcataccattgttgagaaaagtaac
tttacctcttgctcatacacagctatcaacgattgtaatggcaatttattattagctgga
gctgacatggccatcatggaaaaccttagttattcagaaatcaaggatgatcttaatgac
gctaagtacatttgttttgatggtaatatttcaccgtcattgatgctagatataaccaca
tctaaatcgagtaagcaacgagtcgtttttgaaccaaccagtggtcccaaaacattaaag
atactaaaagtcttatctgttgcctcaattgattttataacaccgaacaagtttgaactc
gatgtattatttcaagctatgaaagacggaaatttcttcgagaatgagtcatggtggcag
aagttaaacagctttggtatcacctcctctttctataatgagattgagcgttttacgaaa
agtacaggaatagaagaaattacagaaaacggaatcttacaaaagtgttttcatttactt
cccttcataaagaatattattgttaagttaggacctaatggtgctcttttaataagctct
gagaaacttcaaggagtgaattcaaactcagccagcctttttacccccggaaatgtgact
gtaaagtattaccctgttccaaaagttatagcaacccctgtaaatgctagcggaactggt
gatacttttatcggtactttcactgctttgctttcgaaaggctggggtatggacgatgct
attgatactgctcaaaaagctgcgggcctcactttgcagtgtaatttttcagtaaatcct
gaaataaagactcttttaaaatag

DBGET integrated database retrieval system