KEGG   Schizosaccharomyces pombe (fission yeast): SPBC18H10.16
Entry
SPBC18H10.16      CDS       T00076                                 

Gene name
can1
Definition
(RefSeq) arginine transporter Can1
  KO
K14429  solute carrier family 12 (potassium/chloride transporters), member 9
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC18H10.16 (can1)
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   SPBC18H10.16 (can1)
SSDB
Motif
Pfam: AA_permease AA_permease_2 SLC12
Other DBs
NCBI-GeneID: 2540830
NCBI-ProteinID: NP_001342720
PomBase: SPBC18H10.16
Position
II:join(1797014..1798754,1798801..1800212)
AA seq 1050 aa
MARLLTKSSQVFDFLADRLSVRKSRRFWETQENLESSTPLLQEPQQSYRSNSFNELPPLS
RSVTFAENEQPNEAVKLGTFEGCFIPTTLNVLSILLYLRFPWIIGEAGVLKTLLMLFISY
AVGIFTSLSISAICTNGMVRGGGAYYAVSRSIGPELGGSIGLIFYVGQILNTGMNISGFV
EPIISIFGKESGTISQFLPEGYWWVFLYTTCVLAMCCILCCLGSAIFAKASNALFVVIIL
STISIPISSIFVHPFKDPSLLVHFTGLKWSTLMKNLASAYTENEKGTGYESFKSTFGVFF
PATAGLLAGASMSGDLKAPSRSIPKGTISSQATTFLLYLLVILCVGASVTRTGLLLDMDV
MEHISLHPLFIISGILSSGAFSSFMGIFGAAKLLQAIARDDLIPGMFFFAKGSSYDDIPY
VAIGVTYLITQISLFWDINMLSSMITMTFLLTFGFINLSCFLLRISSTPNFRPTFRYFNR
RTTLVGTILSFGVMFYVDRLNAFISFLIAGILVVVIYFTCPPKNWGDVSQGIIYHQLRKY
LLQTNKARENIKFWRPQILLLINNPNRSENVIRFCNSLKKGSLYILGHVIVSDDFQASMD
DLRKQQRLWHQFVLDRGIKAFVELTIAPDEVWGIRGLISSAGLGGIRPNIAVLTFINTNY
RRHRIYSGSSFSLENTSEESESDSKKEFVEHDILPVKWVQILEDMLVGSVDVMVTNGFDR
LNWPKRKGEKQYIDMFPIHRISGVGSEVNESTPTFATNFETYTMVFQLSWILHTASDWKQ
GCRLRLITLVEFENEIEAERESMHQMLETFRIKADVVVLCLAAMNLDAYRYIVKNEHVRP
SKSSELENLLKDDSWWQEEKKRRGNTVDSLGPIRFPRRMSGYNFRSASFDKSAPPLSVPL
SFRLGPHMHSVKSFETESSFGNRSLSPKQENRRTYSDSTIESSLMPNVVREDSSSDRLAP
KKKIGRDYSKEKLTFNDLSSRSQYIIMNEIVLKHTKNTSVLFTVLPAPLADTHKSFRKSE
EYVDDLLIFMEGLPPCALIHSKSLTITTAL
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggcaagacttttaactaaatcaagtcaagtatttgattttttggcagatagattatca
gtacgaaaatccagacgattttgggaaacacaggaaaatttagagtcttccacaccttta
ttacaagaaccacaacaaagttatcgtagtaatagttttaatgaattacctccgttgtct
agaagtgtaacgtttgctgagaatgaacaaccaaatgaagcggtgaaattgggaacgttt
gaaggttgtttcattccaactactttaaacgtactctccatccttctttatttgagattt
ccttggattattggagaagctggtgttcttaaaacattgctgatgttatttattagttat
gcggtaggtatatttacaagtctatcgatctctgcaatttgcacgaacggtatggtacgt
ggcggaggtgcatattatgcggtttctagatctattggccccgaattaggaggctcaatt
ggtttgatattctatgttgggcagatactgaatactggtatgaatatttctggttttgtt
gagcccattataagcatttttggaaaagaatcaggcactatttcacaatttttacccgaa
ggatattggtgggtctttttgtatacaacttgtgtcctcgcaatgtgttgtattttatgt
tgtttaggttctgccatttttgctaaggcctcaaacgccctttttgtggttataatactc
tcaacaatatcgataccaatctcttcgatatttgttcatcctttcaaagatccttcctta
ctcgttcattttacgggattaaaatggtctacgctgatgaaaaatttagcatctgcttac
acagaaaatgagaaaggaacaggttatgaatcttttaaatctacatttggcgtatttttt
cctgcaacggcaggtctactggctggcgcaagcatgtctggtgatcttaaagcaccttct
cgttctatccctaaaggtactatatcttctcaagcaacgacctttttgctttatttgcta
gtaattttatgtgttggtgcctctgtaactcgtacgggacttttacttgatatggacgtt
atggaacatattagtttacatcctttattcatcatttctggaattctttctagtggcgcc
tttagctcgtttatgggtatatttggagctgcaaagctattacaggcaatcgcgcgagat
gatttaatacccggaatgtttttctttgcaaagggttctagctacgatgatattccttat
gttgcaattggagtgacttacttaattacgcaaatcagtttattttgggacatcaatatg
ctttcttcgatgattacaatgacttttcttctgacttttggctttatcaacttatcgtgt
tttctgttacgaattagtagtaccccaaattttcgacctacctttcggtatttcaataga
cgcactacactggtgggtaccatcttgtcatttggcgtaatgttttacgttgatcgcttg
aatgcctttatctcatttttaattgcaggaattttggtggtagtcatatatttcacatgt
cctcctaaaaattggggtgatgtgtctcaaggcatcatttatcatcaacttcgaaaatac
ttgctgcaaactaataaagcaagagaaaatataaagttttggaggcctcaaattttactt
ttgattaacaacccgaatcggtcagaaaatgttatccgtttctgcaattcattaaagaaa
ggttccctctatatcttagggcacgttattgtatccgatgattttcaggctagcatggat
gatttaagaaagcagcaacgtctttggcatcagtttgtccttgatcgaggtatcaaagca
tttgttgaactaactattgctccagacgaagtttggggtatccgtggtcttatatcttct
gcaggcttggggggaattcgtccaaacatagctgtgctaacatttattaatacgaattat
cgtagacatcgtatatactcgggttcttctttctctcttgagaatactagtgaagaatca
gaatctgacagtaaaaaagaatttgtggagcatgatatactacctgtgaagtgggtacag
atattggaagacatgcttgttggttcggtggacgttatggtaactaatgggttcgataga
cttaattggccaaaaagaaagggagaaaagcaatatatagatatgtttcccattcataga
atatcaggtgtggggtcagaagtcaatgaaagtacaccaacgtttgcgacgaatttcgag
acgtatactatggtttttcaacttagttggatccttcatacagcttcagattggaaacaa
ggttgtaggctacggcttatcactcttgttgaattcgagaatgaaatagaggcagaacga
gaaagcatgcatcaaatgctagaaacgttccgtatcaaagccgacgttgtagtgctctgt
cttgctgcaatgaatttggatgcatataggtacattgtcaaaaatgagcatgtgagacct
agcaagtcttccgagcttgaaaacttactgaaagatgactcgtggtggcaggaagaaaag
aaaagaagaggaaatactgtagattccttaggacctattcgttttccacgtcgtatgtct
ggttataactttagatctgccagctttgataagagtgctccacctttaagtgtgccattg
agtttccgccttgggccacatatgcattcagtaaagtcgtttgagactgaatcttctttc
ggaaaccgttctttatcaccaaaacaagaaaatagaagaacttattctgacagtactatt
gagtcatctctgatgcccaacgtggtccgagaagatagttcatctgatagactagcacca
aagaaaaaaataggaagggactattctaaagagaagttgacgtttaacgatttatcctcg
agatctcaatacataattatgaatgaaatcgtgctgaaacatactaaaaatacttctgta
ttgtttactgttttaccagcacctttggccgacactcataagagctttcgaaaaagcgag
gaatatgttgatgacttattaatatttatggaaggattacctccttgtgcattaatccac
tctaagagtttaactataactaccgctctttaa

DBGET integrated database retrieval system