KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19C2.07
Entry
SPBC19C2.07       CDS       T00076                                 

Gene name
fba1
Definition
(RefSeq) fructose-bisphosphate aldolase Fba1
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00030  Pentose phosphate pathway
spo00051  Fructose and mannose metabolism
spo00680  Methane metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPBC19C2.07 (fba1)
   00030 Pentose phosphate pathway
    SPBC19C2.07 (fba1)
   00051 Fructose and mannose metabolism
    SPBC19C2.07 (fba1)
  09102 Energy metabolism
   00680 Methane metabolism
    SPBC19C2.07 (fba1)
Enzymes [BR:spo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SPBC19C2.07 (fba1)
SSDB
Motif
Pfam: F_bP_aldolase
Other DBs
NCBI-GeneID: 2540767
NCBI-ProteinID: NP_595692
PomBase: SPBC19C2.07
UniProt: P36580
Position
II:1688367..1689443
AA seq 358 aa
MGILDIVPTGVITGDNVLKLFTYAREHGFAIPAINVTSSSTAIAALEAAREARSPIILQT
SNGGAHFFAGKESSNEGQKASIAGSIAAAHYIRSIAPFFGVPVVMHSDHCAKKLLPWMDG
MFEADEAYFKIHGEPLFSSHMLDLSEEPKKENIAQVKEYCKRAVPMKIWIEMEIGITGGE
EDGVDNSHVSHTELYTQPEDIWDVYRELSSVTPYFSIAAAFGNVHGVYKPGNVKLQPALL
GQHQAYVKEQLKTTNDKPVFFVFHGGSGSSVNEFRTGIKCGVVKVNIDTDTQFAYVEGVR
DYVLKYKDYLMTPVGNPEGADKPNKKKFDPRVWIHEGEKTMTKRVLTALEDFYTVNTL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggaattctcgatattgtacctactggtgttattacaggtgacaacgttttaaagttg
ttcacctacgctcgtgagcacggattcgccatccctgccattaacgtcacctcctcctcc
actgctattgctgctcttgaggctgctcgtgaggctcgttcccccatcatcttgcaaacc
tccaacggtggtgctcacttctttgctggtaaggaatcctccaacgagggccaaaaggcc
tccattgccggttccatcgccgctgcccactacatccgttccatcgctcctttcttcggt
gtccccgtcgtcatgcactctgaccactgcgccaagaagcttctcccctggatggacggt
atgttcgaagccgatgaggcctacttcaagattcacggtgagcctcttttctcttctcac
atgcttgacttgtccgaggagcccaagaaggagaacattgctcaagttaaggagtactgc
aagcgtgccgttcccatgaagatctggatcgagatggagatcggtatcactggtggtgag
gaagacggtgtcgacaactctcacgtctcccacaccgagctctacactcaacccgaggac
atctgggatgtctaccgtgagctctcctccgttaccccttacttctccattgccgccgct
ttcggtaacgtccacggtgtctacaagcccggtaacgtcaagctccaacccgctcttttg
ggtcaacaccaagcctatgttaaggagcaactcaagaccaccaacgacaagcccgttttc
ttcgtcttccacggtggttccggttcctctgtcaacgagttccgtactggtatcaagtgc
ggtgtcgtcaaggtcaacattgacactgatacccaattcgcctacgtcgagggtgtccgt
gactatgtcttgaagtacaaggactaccttatgacccccgtcggtaaccccgagggagct
gacaagcccaacaagaagaagttcgaccctcgtgtctggatccatgagggtgagaagacc
atgaccaagcgtgttcttaccgctcttgaggacttctacactgtcaacactctctaa

DBGET integrated database retrieval system