KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19C7.12cHelp
Entry
SPBC19C7.12c      CDS       T00076                                 

Gene name
omh1
Definition
(RefSeq) alpha-1,2-mannosyltransferase Omh1
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    SPBC19C7.12c (omh1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPBC19C7.12c (omh1)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SPBC19C7.12c (omh1)
Glycosyltransferases [BR:spo01003]
 Glycan extension
  Yeast mannan chain
   SPBC19C7.12c (omh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 2540706
NCBI-ProteinID: NP_596168
PomBase: SPBC19C7.12c
UniProt: O60160
Position
II:complement(2845923..2847095)
Genome map
AA seq 390 aa AA seqDB search
MVRLPRKFKRVLLLVVLLTLVVFVRFKKQYIPTISVFEGSLIDNRDTLSYFNISNLEPSE
RSEWLPNKRVNAAFVTLARNEDLNDLLKSIRKLEKTFNHKYHYGWVFLNNEEFSDEFKEH
VIEAVSGKCEFGLVPQEQWSIPEYIDQDKMHENWKKLQELGILYADKESYRHMCRFESGF
FYRHPLVQKYEYYWRVEPSVDFFCDLDFDPFAYMKENNKAYAFTITVTEYSETIPSLWPS
TKEFIKMHPNALHPNNALNFISNDDGETYNGCHFWTNFEIAKVDFWESEVYSKYFDYLDK
SGNFFYERWGDAPVHSIAVSLFADRDNIHFFNEIGYWHPGSGHCPLDDATRAKCDCDPYE
SIDYNGWSCLDKFYTAFEMPFPENWSFYSH
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcttgccaagaaagttcaaacgtgttttacttttagtggtattacttacattg
gttgtatttgtacgtttcaaaaagcaatacatcccaactatcagtgtatttgagggcagt
ctgattgacaatcgagatactctttcgtatttcaatatttctaatctagagccctcagaa
cgctccgaatggcttccaaataaacgggttaatgctgcctttgttacgttggcaagaaat
gaagatttgaatgatttacttaaatcaatccgaaaacttgagaagactttcaatcataaa
tatcattatggatgggttttccttaacaatgaggagttctctgacgaatttaaggagcat
gttattgaagcggtctctggcaaatgtgaatttggtttggtacctcaggaacaatggagc
attccggaatatattgaccaagacaaaatgcatgaaaattggaaaaaacttcaagaatta
ggaattctttatgctgacaaagaatcttatcgtcacatgtgtcgctttgagtctggtttc
ttttatcgtcatcctcttgttcagaagtacgaatattattggagagttgaacctagtgtg
gatttcttttgcgacctcgatttcgatccatttgcttatatgaaggaaaataacaaggcg
tatgcattcactatcactgtaactgaatattcagaaacaattccttctctttggccctct
accaaagaattcatcaaaatgcaccctaatgctcttcatcctaataatgctctaaacttc
atatctaatgatgatggggaaacttataacggatgtcatttttggactaattttgaaatt
gcgaaagttgatttttgggaaagtgaagtttatagtaaatattttgactaccttgataaa
agtggtaatttcttctatgagcgttggggtgatgctccagttcatagcattgctgtttcg
ttgttcgctgatcgtgacaatatccattttttcaatgagattggctattggcatcctggt
agcggtcattgtcctttggatgatgctacacgcgctaaatgcgactgtgatccttatgaa
tccattgattataatggatggagctgtctagataaattctataccgcatttgaaatgcct
ttccccgaaaactggtctttttatagccattaa

DBGET integrated database retrieval system