KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19F5.01c
Entry
SPBC19F5.01c      CDS       T00076                                 

Gene name
puc1
Definition
(RefSeq) cyclin Puc1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 2540654
NCBI-ProteinID: NP_001342772
PomBase: SPBC19F5.01c
Position
II:complement(3699573..3700652)
AA seq 359 aa
MLVSSNEEQLTAHTPTSSSSIEPKILAACSYSLSVGPCSLAVSPKGVNSKSPSLKNETAF
VVDSVSTLSAESSALLYNTQSSLLTGLSMNGYLGEYQEDIIHHLITREKNFLLNVHLSNQ
QPELRWSMRPALVNFIVEIHNGFDLSIDTLPLSISLMDSYVSRRVVYCKHIQLVACVCLW
IASKFHETEDRVPLLQELKLACKNIYAEDLFIRMERHILDTLDWDISIPTPASYIPVLDP
IFFLVLDASMFVPNLFKFPASKIACSVMNIVNEHVGSFLLTHPSMESYRKDDNFLWPEDL
DTVTSYMENMSKRYANEECTDLLFSSLGRISSILAKKYPEQCAMAAWCNMTEKDTERTL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgttagtttcttccaatgaggaacaacttactgctcatactcccacttcatcttcaagt
atagaacctaaaatattagctgcctgttcatattctctatcagtgggcccttgctcttta
gctgtttcaccaaaaggcgttaattccaaatctccctctcttaaaaatgagactgcattt
gttgtcgactctgttagcacattgtcagcggaatctagcgccttactttataacactcaa
tcctctttactcactggtttatcaatgaacgggtatttaggtgagtaccaggaagacatt
atccatcatctgattactagagagaaaaattttttgctgaatgtccatctttctaatcag
caaccggaactcagatggtcaatgcgacctgcactcgttaattttattgtagaaatacat
aatggattcgacttgtctattgatactcttccgcttagtatttccctcatggattcatat
gtctcgaggagagtggtatactgcaaacacattcagttagtagcatgtgtttgtctttgg
attgccagtaaatttcatgaaacagaagaccgtgttccattattgcaagaactgaagtta
gcttgtaaaaacatctatgctgaggatttatttattcgtatggaacgccacatacttgat
actcttgattgggatatctcaatccctacaccagcttcgtatattcctgttttagacccg
atttttttcttagtacttgatgcatcaatgtttgtacctaatttattcaaatttcccgct
tccaaaatcgcatgttcagttatgaacatcgtaaacgaacatgtcggatcgtttcttttg
acacacccttctatggaatcctatcgcaaagatgataactttttgtggcctgaagacttg
gataccgtaacatcatatatggaaaacatgtcaaagaggtatgctaatgaggaatgtact
gatttactgttttcctcactaggccgtatttctagtattttagcaaagaaatatccggaa
caatgcgcaatggctgcctggtgcaacatgactgaaaaggatactgagcgtactttgtaa

DBGET integrated database retrieval system