KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19F8.07
Entry
SPBC19F8.07       CDS       T00076                                 
Symbol
mcs6
Name
(RefSeq) cyclin-dependent protein kinase/CDK-activating kinase Mcs6
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC19F8.07 (mcs6)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC19F8.07 (mcs6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPBC19F8.07 (mcs6)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC19F8.07 (mcs6)
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPBC19F8.07 (mcs6)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC19F8.07 (mcs6)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     SPBC19F8.07 (mcs6)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     SPBC19F8.07 (mcs6)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CMGC group
  CDK family
   SPBC19F8.07 (mcs6)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC19F8.07 (mcs6)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     SPBC19F8.07 (mcs6)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBC19F8.07 (mcs6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Haspin_kinase Seadorna_VP7 FTA2 APH
Other DBs
NCBI-GeneID: 2540471
NCBI-ProteinID: NP_596349
PomBase: SPBC19F8.07
UniProt: Q12126
Position
II:3243309..3244568
AA seq 335 aa
MDIEKSDKWTYVKERKVGEGTYAVVFLGRQKETNRRVAIKKIKVGQFKDGIDISALREIK
FLRESRHDNVIELVDVFSTKSNLNIILEFLDSDLEMLIKDKFIVFQPAHIKSWMVMLLRG
LHHIHSRFILHRDLKPNNLLISSDGVLKLADFGLSRDFGTPSHMSHQVITRWYRPPELFM
GCRSYGTGVDMWSVGCIFAELMLRTPYLPGESDLDQLNVIFRALGTPEPEVIKSMQQLPN
YVEMKHIPPPNGGMEALFSAAGHEEIDLLKMMLDYNPYRRPTAQQALEHHYFSALPKPTH
PSLLPRKGGEEGIKHVSSDLQRQNNFPMRANIKFV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggatatcgaaaagtctgacaagtggacgtatgtgaaggagcgcaaagttggtgaagga
acgtatgccgtcgtgttcctgggtcgccaaaaagaaactaatcggcgtgtggctattaaa
aagattaaagtgggccagttcaaagatggtatcgatataagtgctttacgagagatcaaa
tttcttcgggagtcaaggcacgacaatgtcatcgagttagttgatgtattctccacaaag
tccaacctcaacatcatcttggaattcctggacagtgatttggaaatgctgatcaaagac
aaattcatcgtttttcaacctgcccacatcaaatcgtggatggtcatgttgttacgcggt
ttgcatcacattcattctcgcttcatccttcatcgagatttgaagcctaataacctttta
atttcgagtgacggtgtcctaaaattggctgattttggcctttctcgtgattttggcacc
ccaagccacatgagtcatcaggtcattacacgatggtacaggcctccagagctatttatg
ggttgtcgaagctatggcaccggtgttgatatgtggagtgtaggctgcatttttgcagag
ttgatgcttaggaccccgtatttgccaggcgaatctgatctggatcagcttaacgtaatt
ttccgcgctcttggaactcctgaaccagaggtcattaaaagcatgcaacagcttcccaac
tacgttgagatgaaacacattcctcctcctaacggtggtatggaggctcttttttcggca
gctggccatgaagaaattgatttactcaagatgatgttggattacaatccatatcgtcgt
cccactgctcaacaagcccttgagcatcattatttttctgcccttcctaaacccacacat
ccttctcttctcccacgcaaagggggtgaggaaggaatcaagcacgtctctagtgacctg
cagcgacaaaacaactttccaatgcgtgcaaatattaaatttgtttaa

DBGET integrated database retrieval system