KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19G7.01c
Entry
SPBC19G7.01c      CDS       T00076                                 
Symbol
msh2
Name
(RefSeq) DNA mismatch repair protein
  KO
K08735  DNA mismatch repair protein MSH2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPBC19G7.01c (msh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC19G7.01c (msh2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     SPBC19G7.01c (msh2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV MutS_I AAA_27
Other DBs
NCBI-GeneID: 2540695
NCBI-ProteinID: NP_001342761
PomBase: SPBC19G7.01c
Position
II:complement(2343653..2347813)
AA seq 982 aa
MSSRNASIANERTDEARMFNFYEKMPKDTNTVRVFDRGEFYVAIGEDASFVAQNAYHTTS
VLKHHNVSNTSYCNLSPSLFIKFAEDVLSNLAKRVEIWGANSAKTGFELLKQASPGNMQM
LEDLLVSENYQESTAISDSSVSSVLLAVTTRVKQDQRIIGVAFIDPILKKLGVSEFVDSD
AYTNFEALIVQVGAKECIISQSGHESTNGNSAVSINTAEINRLRNIIEGCGALVTTIRSS
EFSARDVELELSKVLDSPVTHALVPELGLQLAMASCNALLRYLGPALLNPDMEDDRENTS
RKLHLYHHNLEQYMRLDIAAVRSLNLLPPPNGNAHKTMSLYGLLNHCRTAMGARNLRRWI
VQPLLDAKSIERRHDLVSALVEDAEARQLLLDDDHLLRSIPDIPKLCRRLTRGSASLEDV
VRIYQMAKALPKIVTVLDSLTSEHKDLVDKVYTNVLNNHCKNLEKLIELVETTIDLEALD
SHQYIIRAEFDEELLDLRQRLDELQHSIFEEHKRVGSDLHQDTEKKLHLEQHHLYGWCLR
LTRTEAGCLRGRSSHYTELSTQKNGVYFTTKRLHSLNNSYMDHQKSYRYHQNGLAREVIK
IAATYGPPLEAIGQVIAHLDVILSFAHASTVAVIPYVRPNIVDSSIAQEKHGQSSNILDI
VSLEDTPNFEEIRRTLENNHCARLYLKQARHPCLEAQDDVKFIPNDVNLEHGSSELLIIT
GPNMGGKSTYIRQVGVITVMAQIGCPVPCEVADLDIIDAILARVGASDSQLKGISTFMAE
MLETATILRAATPRSLIIIDELGRGTSTTDGFGLAWAITEHIVTQIGCFCLFATHYHEMT
KLSEEITTVKNLHVTAYVGDSESKDVALLYNVCEGASDRSFGIHVAKLAHFPPKIIEMAS
NKAAELEAEDSGAQGDTQEVKSKKEGMAIVRDIMRQWRSNVKPEMTQQQMMDQFQKVIGS
FAQQINSNNWLQSRVSTNEVSS
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgtcttctagaaacgcttcaattgctaatgaaagaactgatgaggcaaggatgtttaat
ttttatgaaaaaatgcctaaagatacaaacacagtgcgtgtatttgatcgaggggaattt
tacgttgcaataggagaagacgcttcgtttgttgctcaaaacgcgtatcacactacttcg
gtgctaaaacaccacaatgtgtctaatacatcttattgtaacttatctccttcactattt
attaagtttgcggaagatgttttaagcaaccttgcaaagagagttgaaatttggggagcc
aattccgcaaagacaggatttgaattgttgaagcaagctagtcctggaaatatgcaaatg
ctggaagatttgcttgttagtgagaattatcaagaatccacagccattagtgatagctca
gttagttcggttttgttggctgttactactagggttaaacaagatcagcgaataattggc
gttgcttttatagatccaattttaaaaaaattaggtgtttcagaatttgttgactcagat
gcttatacgaactttgaagctctcatagtgcaagttggagcgaaagagtgcataatatcg
caatctgggcatgaatcgacgaatggcaattcagccgtttctattaacacggcagaaatc
aatcgtcttcgaaatattattgaaggttgtggcgcattagttacaactataagaagctct
gaattttcggctcgagatgttgaacttgagctctcaaaagtgctcgacagtccagttaca
catgctcttgttccagaactaggtctacaattagcaatggcatcctgcaatgcattgctt
cgctatttaggacctgcgttactaaaccctgacatggaagacgaccgtgaaaacacatct
cgaaagctccatctgtatcatcacaacttggaacaatacatgcgattagatattgcagca
gttcgttctcttaacctacttcctcctcccaatggtaatgctcataaaacaatgagtctt
tatggtttacttaatcattgtagaactgcgatgggagcaaggaatttaagaagatggatt
gttcagccacttttggatgcaaaatcaattgaacgaagacatgacttggtctccgcactt
gtggaagatgctgaggcacgccagttattgcttgatgatgatcatcttcttcgttcaatt
ccagatattcctaaactatgcaggcgtttaactcgtggatcagctagtctagaagatgtt
gtacgtatttatcaaatggcaaaggcacttccgaagatcgttacggtacttgactctttg
actagtgaacataaagatttggtggataaagtatacacgaacgtccttaacaatcattgc
aaaaacttggaaaaattaatagagcttgttgaaaccaccatcgacttggaagcattggat
tcacatcagtatattatccgtgcagagtttgatgaggagctattagatttgcgtcaacga
ttagacgaattacagcattctatctttgaagaacataaaagggtcggttcagatctccac
caagataccgagaaaaaattacatcttgagcaacatcacctctatggatggtgtctacgc
cttactagaacagaagctggctgtttaagaggccgtagttctcattatacagaattatca
actcaaaaaaatggagtctactttaccactaaacgtcttcattcactaaacaattcttat
atggatcaccaaaaaagctaccggtaccaccaaaatgggcttgcacgtgaagttataaag
atagctgcaacatacggtcctcctttggaggcgattggccaagtaattgctcatttggac
gtgattctaagtttcgcacatgcaagtacggtagctgtaataccttatgtaagaccaaat
attgtggattcaagcattgcacaagaaaagcatggacaaagtagcaatattttggacatt
gtttcattagaagatactcctaattttgaagaaatacgaagaactctagaaaataatcat
tgtgctcgtctctacctaaaacaagcgcgacatccttgtttggaagctcaggacgatgtg
aagttcatacccaatgatgttaatcttgagcatggaagttcagagctattaatcataacc
ggaccaaatatgggtggaaaatcaacgtatatccgtcaagttggagttattaccgtcatg
gcacagattggttgtccagtgccttgtgaagtggctgatctagatattattgatgctatc
cttgcacgtgtcggagccagcgactcacagcttaaaggcatttctactttcatggccgaa
atgttggagaccgctacgattttgagagctgccacaccgcgatccttaatcatcattgat
gaattaggacgagggactagcacaaccgatggttttggattagcgtgggctattacagaa
cacatcgtgactcaaatcggttgcttttgccttttcgcaacacattatcatgaaatgacc
aaactatcagaagaaatcactactgtcaaaaatttgcatgttacagcctatgtaggtgat
tcagaatcgaaggatgtagctttactctataatgtttgtgaaggagctagtgatcggagt
tttggaatccatgttgctaaacttgcgcacttccctcccaagattattgaaatggcaagc
aacaaagccgcagaattagaagctgaagactctggagcccaaggggatactcaagaagtg
aaatctaaaaaagaaggtatggcaattgtacgtgatataatgagacaatggcgtagcaac
gtcaaaccagaaatgactcagcaacaaatgatggaccaatttcaaaaagtcatcggctca
ttcgcacagcaaatcaattccaacaactggctacaatccagggtatccacaaatgaggtt
tcctcatga

DBGET integrated database retrieval system