KEGG   Schizosaccharomyces pombe (fission yeast): SPBC19G7.15
Entry
SPBC19G7.15       CDS       T00076                                 

Gene name
nup44
Definition
(RefSeq) nucleoporin Nup44
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Nup54 Nucleoporin_FG Lipoprotein_20
Other DBs
NCBI-GeneID: 2540775
NCBI-ProteinID: NP_595981
PomBase: SPBC19G7.15
UniProt: O42963
Position
II:join(2378035..2378050,2378095..2379290)
AA seq 403 aa
MAFSFGQQGSSIKAPSIGSTGVFGQSNTTKPTAPFGSGSIFGSTNTNVGAGGPTGSSSAP
PFGNSIFGKTQQQPTTSFSNTTTNAPQSTVFGQNAASRTGNSNTQPLFSWSTVNNPTKPV
DETNATIPSSLLLSSGISPNATVSNAQYGPAQPPSVEEQVQKILNAWNLNHPDCAFQRFF
YNKVPVEQAALYVKPPNYNQQKWDEAVANRPSNSVVPVLAVGFPDVQKRINMQIQQVNTY
RIRMREIVETLGRLSNKHDLDFSIKLAEAKNRHVRLSERILRLAIKVHVLRHRGYALKPN
EEELRKKLDDLTKSLNNPEIFGRLNEIWARITLIFEGEKISEDQRSNLAKGVVDWRKNSD
QLEVITDVLRDHQVGLSYVVKLMQEDLATLNKQLTEHVPQSQK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcattttcttttggtcaacaagggtcgtcaataaaggcaccttccattggctcaact
ggcgtttttggccagtcgaataccacaaaaccaactgcacctttcggttctggatctatt
tttgggtccacaaacactaatgtaggtgcaggaggccctactggttcttcgtcagctcca
ccgtttggaaattcaattttcggtaaaacacaacaacagccgaccacttctttctccaat
actaccaccaatgccccacaaagtactgtatttggccaaaacgctgcatcaagaaccggc
aactcaaatacgcaaccattattttcgtggagtacagtcaacaatcccacaaaaccagta
gacgaaaccaatgctacgatccctagcagcttattgctgtcttcaggtatatccccaaat
gcgaccgtgagcaatgctcaatatggccctgctcaacctccgtccgtggaggagcaagtg
cagaaaatcttgaatgcatggaatctcaaccatcctgattgtgcttttcagcggttcttt
tataacaaggttcctgttgagcaagctgcactatatgttaagcctccaaattataaccaa
caaaaatgggacgaagctgttgctaatcgaccaagcaacagtgttgttcccgttttggcc
gtaggattccccgatgtacaaaaaagaattaatatgcagattcaacaagtgaacacgtac
cgtattcggatgcgtgaaattgttgaaactttaggaagattaagtaacaaacacgacctt
gattttagcatcaaacttgccgaggcgaaaaatcgtcacgtccgtctgtctgaaagaatt
ttacgacttgcaattaaagtacatgttttacgacatcgtggttatgcactaaaacctaat
gaagaagagctacgtaaaaaattagatgatttaacaaaatcgctaaataatcctgaaatt
tttggtcggctcaacgaaatatgggcaagaattactcttatttttgaaggagaaaagata
tctgaagatcagcgaagtaatttggctaagggagtagtggattggcgaaaaaattctgat
caactagaagtcattacggacgtcttaagggatcatcaagttggtctttcatatgtggta
aaactgatgcaagaagatttagcgacgttgaacaagcaattaactgagcacgttcctcaa
tcacaaaaatag

DBGET integrated database retrieval system