KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1E8.03c
Entry
SPBC1E8.03c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: NurA
Other DBs
NCBI-GeneID: 2540688
NCBI-ProteinID: NP_595801
PomBase: SPBC1E8.03c
UniProt: O42968
Position
II:complement(1960384..1961817)
AA seq 477 aa
MVVIANKGALWAYYCKRLLNSVTYMMYPLIRKRTMKKLLLIVGLLLACSTVMRRIPLFHE
SFHLPSLDPRASTTTSQKFQEYRSDFLEKLETAEPPEDVIMFTAYGLGVHTHNLFMLACD
MAKTSDSQIRFLLLTDGTILPEALYDYNRETVSTCPLSFLSYSTGVERLSKELILKDLLS
LQFQQALLAISPSVIVTSEHSPLVMFQAINPYLNNNYYTHDTVDTNALEENSWITKLDMQ
SLQHFRTPRINVVLIVEDGTYKYLLNLMRDLGRDFKNSEEYPHLFIHLFMSENIPNLSSI
RANWPQHRLFINLHFNQKDLNLIEVWTPPNDYTYALVVDLQPDSPPQLSSNLITWLKYKI
LLIYYHKSSSTYKNNIAAIVPSFDFSNEEAVILSQTINSNIVLFAPVVFQKFQEYMAVRL
LNPNFELPESNGIEFAHEDSVLGHSKPSLTEFHAILGLYSLVISYNHFEGSLSNEYV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggttgttattgctaacaagggtgcgctttgggcttactattgcaaaagattgttaaat
tcagttacatatatgatgtatccattaattaggaaacgcaccatgaaaaagcttttatta
atcgttggtttacttcttgcctgtagcaccgtaatgagacgcattccccttttccatgaa
agtttccatttgccctcactagatcctcgtgcttcaaccactacgtcccagaaatttcaa
gaatacaggagcgattttttagaaaaactagagactgccgaacctccagaagatgttatc
atgtttaccgcttatggattaggtgttcatactcataacctttttatgcttgcttgtgat
atggctaaaacatccgactcccaaattcgtttccttttgttaacagacggaacaattcta
ccagaagctctgtacgattataatcgtgaaactgtttcgacatgtcctttgagttttctt
tcctatagtacaggtgtagaacgtctgtcgaaagaattaattttaaaggacctgctttct
ttgcagtttcagcaagcccttttggctatatctcccagcgttatcgtaacctccgagcac
tctccactagtgatgtttcaggcgataaatccttacctaaacaataattattatactcat
gatacagtcgatacgaatgctcttgaagagaatagctggataacaaagttggatatgcaa
tcattgcagcatttccgtacccccagaataaatgttgtactgattgtggaagatggtact
tacaagtatcttctaaatttaatgcgagatttgggtagggacttcaagaattcggaagag
tatccacatttgttcattcacctctttatgtccgaaaatattcctaatctttcttcaatt
cgtgctaattggcctcaacatcggctttttattaacctgcattttaatcaaaaagattta
aatttgattgaagtttggacaccaccgaatgattatacgtacgctcttgttgtcgattta
caaccggactccccaccacaactttcttcgaatctaattacatggcttaagtataaaatt
ctattaatttattatcataaatcgtcgtccacttacaagaataatattgctgctattgtt
ccttcttttgatttctctaatgaagaggcggtgatactttctcaaacgattaattcaaac
attgttctttttgctcccgttgtattccaaaagtttcaagagtatatggctgttcgatta
ttgaatcctaactttgagcttcccgaatcaaatggtatagagtttgctcatgaagactct
gttttaggacattcaaaaccaagtttaacagagtttcatgccattttaggtctttattcg
ttagtaatttcttataaccattttgaaggaagcttgagcaacgaatacgtttag

DBGET integrated database retrieval system