KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1E8.05
Entry
SPBC1E8.05        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GPI-anchored
Other DBs
NCBI-GeneID: 2540552
NCBI-ProteinID: NP_595802
PomBase: SPBC1E8.05
UniProt: O42970
Position
II:1970914..1971867
AA seq 317 aa
MKLSFILSTLVAGALAYNEFSAPGPNAVLQEGGGVNTVSWSNLTSSTVTLTLYRGGNSAL
TPIETIASDIDNTGTYLWNIATYYEAADDYLLGLSFDGGETYSQYFTLQACSTCTISTSS
LSYSGTISSTSIAPSMIGTRTSSSYFITSSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSS
SSSSSSKSSSSSSSSSKSSSSSSSSSKSSASPSSSKSSSKFSSSSFITSTTPASSSSSGA
IVSNAKTASTDDSSSASSATSSVSSVVSSASSALSASASSASASVSSSASSDASPALKTG
INALVAVGVVSAIALFL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaagttgtctttcattttatctactctcgtcgccggcgctttggcatacaatgaattc
tctgcccctggacctaatgccgtccttcaagagggtggtggtgtaaacactgtttcttgg
agcaatttgacttctagcactgtcactttgactttgtaccgcggtggtaactctgcactt
actcctattgagaccattgcttctgacattgacaacaccggtacttatctctggaacatt
gctacttactacgaggctgctgatgattacttgcttggtcttagctttgacggtggtgag
acttattctcaatactttactttgcaagcttgctctacttgtactatctccacttctagc
cttagctacagtggtaccatttcttctacctcgatcgctccctctatgattggtactcgt
acttcttcctcttactttatcacttcctcctcctctactccctcctcttcttcctcttcc
tctagctcctctccctctagctcttcttccaagtccagctccagctccaagtctagctct
tcctccagctccagctccaagtctagctcttcttccagctctagctccaagtccagctct
tcttccagctctagctccaagtctagtgcttctcctagctcttccaagtcttcttccaaa
ttctcttcttctagctttattacctctaccactccagccagttcttctagtagcggtgct
attgtttctaacgccaagactgctagcactgacgactctagctctgccagctctgccact
tccagtgtatccagcgttgtcagctctgctagctccgctctctctgcatctgcttcatcg
gcctctgcttctgtttctagctccgcctcttctgatgcttcccctgctttgaagactggc
atcaatgcattggttgctgttggtgttgtttctgctattgccttgtttctttaa

DBGET integrated database retrieval system