KEGG   Schizosaccharomyces pombe (fission yeast): SPBC20F10.03
Entry
SPBC20F10.03      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: IFRD tRNA_NucTran2_2
Other DBs
NCBI-GeneID: 2540757
NCBI-ProteinID: NP_596367
PomBase: SPBC20F10.03
UniProt: O42973
Position
II:3287750..3289090
AA seq 446 aa
MGKKDGKRQLMSDDDSFDTISILSGSMDQLSVGSMEDSGILKGSKTWLEELESTIDDLIE
VKKIGAKEREEHLEKIYVICTRHYAKRISENVASLEELLLKIFNGPRSDKELILTIRIMC
TFCLASVFQVEELWTKTEGRFNALANDAESSGIKCESILCFSLLTALLDSEADVIEFGDF
LISILESDGAVVNSEDDEGVVGCACQALGLLLTCVTTESEFLASAAEALSEQLDAASIDV
QLAAGQALAALFERVNEIRPDKDEENDESDVSQTSKFDDIIPDRNQLLITLRDLASESSK
SIGKKQRKVLHQVFRNVLQTIEEPNARNILRNSVRIGQSTVQLDSWKKILRAQMLRYVLG
SSFSEYFAKSTFIRYFLGYSGYVAGLSSRDPDSDFDSDNVDEYIDDHKRGLSSTERRDLD
RVRDKQKKQDQRVRADYINSVYFSQN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgggcaaaaaagatggtaaaaggcagttaatgtctgacgatgactcttttgacactatc
agcatacttagtggctccatggatcagttaagtgttggttctatggaggattcaggtatt
cttaaaggttcaaaaacttggcttgaagaattggagtccactattgatgacttgatagaa
gtaaaaaaaattggcgccaaagaacgagaagaacatctagagaagatatatgtaatatgc
acacgacattacgctaaaaggatttccgaaaatgtagcatctttggaagaattactttta
aaaattttcaacggacctcgttctgacaaagaattgattttgacaattcggatcatgtgt
actttttgtctggcttctgtttttcaagtggaagagctgtggacgaagacagaaggaaga
tttaacgcattggcaaatgatgcagaatcttctggcatcaagtgtgaatccatactttgt
ttctctttattgacagctcttttagactccgaagcagatgtaattgaatttggagacttt
ttaatcagcattttagagtctgatggtgctgttgtgaattctgaagatgatgaaggtgtg
gttgggtgtgcatgccaagctctaggtttgcttttaacttgcgtcacaactgaaagtgaa
tttttagcttcggcggctgaggctctttctgagcaactagatgcagctagtattgatgtt
cagttagcagcgggccaagctcttgctgcgttgttcgaaagggttaatgaaattaggccg
gataaagatgaagagaatgacgaaagtgatgtttctcaaacgtcaaaatttgatgatatt
atccccgaccgtaatcaattacttattacccttcgcgaccttgctagtgaatcttctaaa
agcattggtaaaaaacaaagaaaggttctccatcaggtttttcgtaacgttctacagacg
atcgaggaaccaaatgctcgcaatatcttgagaaatagtgttcggattggccagtctacg
gtgcaactggactcatggaaaaaaattttgagagcacaaatgctacgttatgttttgggt
tcttccttttcggaatacttcgcgaaaagtacttttattcgttatttccttggttattcc
ggatacgtcgcaggcttaagctctcgtgaccctgattcagacttcgattctgataacgtt
gatgaatacatagacgatcataaaagaggattatcttcgacagaaagaagggatcttgat
cgtgtacgtgacaagcagaagaaacaagatcagcgcgttagagctgactatatcaattct
gtctacttttctcaaaattaa

DBGET integrated database retrieval system