KEGG   Schizosaccharomyces pombe (fission yeast): SPBC20F10.04c
Entry
SPBC20F10.04c     CDS       T00076                                 

Gene name
nse4
Definition
(RefSeq) non-structural maintenance of chromosome element 4
  KO
K22825  non-structural maintenance of chromosomes element 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC20F10.04c (nse4)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     SPBC20F10.04c (nse4)
SSDB
Motif
Pfam: Nse4_C Nse4-Nse3_bdg
Other DBs
NCBI-GeneID: 3361330
NCBI-ProteinID: NP_001018837
PomBase: SPBC20F10.04c
UniProt: Q6BDR8
Position
II:complement(join(3289466..3289558,3289606..3289697,3289743..3289962,3290001..3290094,3290138..3290396,3290441..3290521,3290565..3290628))
AA seq 300 aa
MSSIDKRDLRKRYRNLINKVQESRLELVDEENNNLYETITTANDLFSSVDAPTEATLDAL
LLTKTVDLASIKARQLHIGRPKFNIELFTKNIKQFLNYPTSHSNVTRIQEIDTAWSRLGK
LASNCEKQPASLNLMVGPLSFRKKERNIQRRERLQKAPNVLTQPTMLNERNITTQENNTT
KNVLHISRLLQAHQPVNFLKFITNPQSYPQTVENLFYVSFLFKEGKAALVENESGILMLE
TRIPPTDDQVVAGEIRNIQLVLDMTMDLYENIIKEYNIKESIIPTRAPVETSTNSNTWYG
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcctccattgataaacgggatcttagaaaacgatataggaacttaataaacaaagtt
caagaaagtcgtttggaactggttgatgaggaaaacaataacttatatgaaactattact
actgctaatgatttattttcttcagttgatgctcctactgaagcaaccttagatgcttta
ctgcttactaaaacggttgatctggcttccattaaagctaggcagcttcatattggaagg
cccaagtttaatattgaactattcacaaaaaatattaagcaattcctcaactatcctact
tcccactcgaatgttactcgaatccaagaaattgacacagcatggtcaagactagggaaa
ttggcaagtaattgcgaaaaacagcccgcttctctgaacttgatggtcggtcctttatca
tttcgcaagaaagaaagaaacatccagcggcgagaaagactacaaaaagccccgaatgtg
ctaactcaacctactatgctgaatgaacgtaacattactacccaagaaaataacaccact
aaaaatgtcttgcacatatctcgtttacttcaagcacaccagcctgttaattttttgaaa
ttcatcaccaatcctcaaagttatcctcaaacagtggagaacttgttttatgtcagcttt
ttattcaaagaaggcaaagctgccctcgtagaaaacgaaagcgggattctcatgcttgaa
acacgcattcctccaacggacgatcaagtcgtggcaggcgaaataagaaacattcaattg
gtactggatatgacaatggatttgtacgagaacataattaaagaatacaatatcaaagaa
agcattattcctactcgagcacccgttgaaacatctactaacagtaatacttggtatggc
tga

DBGET integrated database retrieval system