KEGG   Schizosaccharomyces pombe (fission yeast): SPBC211.08c
Entry
SPBC211.08c       CDS       T00076                                 

Definition
(RefSeq) exosome complex component mtr3
  KO
K12587  exosome complex component MTR3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SPBC211.08c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPBC211.08c
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     SPBC211.08c
SSDB
Motif
Pfam: RNase_PH
Other DBs
NCBI-GeneID: 2540412
NCBI-ProteinID: NP_596618
PomBase: SPBC211.08c
UniProt: Q9P7R3
Position
II:complement(join(3887467..3888125,3888164..3888278))
AA seq 257 aa
MSDRKRVYGPSVSVPPYFEEPEQPVFTRTRDVDRCRKIYLKLGWATKAVGSSYFESEKIK
IACTVSGPRPSKTFAFRSSAKLNCEFRLSPFSTSVRQGHVQTVEEKSYSQMIEAAISPSI
LLHLYPKSSIDVYIQVIESDGALATLAAAISCASSAIADANIDCIDLVTGSSVLFNPNTD
EYWIDPDYVDERARAAKGSVVMGYMASLGHVTQVWERGTCSPSRLSFLTEKCIKNAKDTR
LVINHALLLEKSKSEDP
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtcagatagaaagagagtgtatggaccgagtgtatccgttcccccttattttgaagag
ccagaacaacctgttttcacgcggactcgtgatgttgacagatgtcgaaaaatatatcta
aaattagggtgggctactaaagctgtcggtagcagttattttgaatcagaaaaaataaaa
attgcatgcacagtctctggtcctcgacctagtaagacttttgcttttcgttcatcagca
aagttgaattgtgaatttagattatccccattttctacttctgttcgtcagggacatgta
caaaccgtcgaagaaaaaagctattcccaaatgattgaagcagcaatttctccaagtata
ttactgcatttgtatccgaaaagttctatagacgtttatattcaagtgattgaaagtgac
ggtgcattagcaacattggctgctgctataagttgcgcatcaagtgcaatagctgatgct
aacatcgactgcatagatttggtgacgggctcgagtgtattatttaatcccaatacggat
gaatattggattgatcctgattatgtggatgagcgtgcaagggctgctaaaggttctgta
gttatggggtacatggcttctcttggtcacgttactcaagtatgggaaagaggcacttgc
tctccgagtcgcctttcgtttttgacggaaaaatgcataaagaatgccaaagatactcgg
ttagtaattaatcatgcactgctactagagaagtcgaaatccgaagatccttag

DBGET integrated database retrieval system