KEGG   Schizosaccharomyces pombe (fission yeast): SPBC215.09cHelp
Entry
SPBC215.09c       CDS       T00076                                 

Gene name
erg10
Definition
(RefSeq) putative acetyl-CoA C-acetyltransferase Erg10
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00071  Fatty acid degradation
spo00072  Synthesis and degradation of ketone bodies
spo00280  Valine, leucine and isoleucine degradation
spo00310  Lysine degradation
spo00380  Tryptophan metabolism
spo00620  Pyruvate metabolism
spo00630  Glyoxylate and dicarboxylate metabolism
spo00640  Propanoate metabolism
spo00650  Butanoate metabolism
spo00900  Terpenoid backbone biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
spo01212  Fatty acid metabolism
Module
spo_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPBC215.09c (erg10)
   00630 Glyoxylate and dicarboxylate metabolism
    SPBC215.09c (erg10)
   00640 Propanoate metabolism
    SPBC215.09c (erg10)
   00650 Butanoate metabolism
    SPBC215.09c (erg10)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPBC215.09c (erg10)
   00072 Synthesis and degradation of ketone bodies
    SPBC215.09c (erg10)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPBC215.09c (erg10)
   00310 Lysine degradation
    SPBC215.09c (erg10)
   00380 Tryptophan metabolism
    SPBC215.09c (erg10)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPBC215.09c (erg10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC215.09c (erg10)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPBC215.09c (erg10)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC215.09c (erg10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 2540616
NCBI-ProteinID: NP_596686
PomBase: SPBC215.09c
UniProt: Q9UQW6
Position
II:complement(join(4045979..4047155,4047216..4047226))
Genome map
AA seq 395 aa AA seqDB search
MVNTEVYIVSAVRTPMGSFGGSFASLPATKLGSIAIKGALERVNIKPSDVDEVFMGNVVS
ANLGQNPARQCALGAGLPRSIVCTTVNKVCASGMKATILGAQTIMTGNAEIVVAGGTESM
SNAPYYAPKNRFGAKYGNVELVDGLLRDGLSDAYDGLPMGNAAELCAEEHSIDRASQDAF
AISSYKRAQNAQATKAFEQEIVPVEVPVGRGKPNKLVTEDEEPKNLNEDKLKSVRAVFKS
NGTVTAANASTLNDGASALVLMSAAKVKELGLKPLAKIIGWGEAAQDPERFTTSPSLAIP
KALKHAGIEASQVDYYEINEAFSVVAVANTKILGLDPERVNINGGGVAMGHPLGSSGSRI
ICTLAYILAQKDAKIGVAAVCNGGGGASSIVIERV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggttaacacagaggtttacattgtgtctgctgttcgcacacccatgggcagctttggc
ggcagtttcgcttctcttcctgccaccaaattaggctctattgccatcaagggcgctctt
gaaagggtcaatattaagccttctgatgttgatgaggtgtttatgggtaatgtcgtctca
gccaatcttggccaaaaccctgctcgtcaatgcgccttaggtgctggactccctcgttcc
atcgtttgtactactgttaacaaggtttgtgcctctggtatgaaggcaacaattctcggt
gctcaaactatcatgactggaaatgctgagattgtcgttgctggtggtaccgagagcatg
tcaaatgctccttactatgccccaaagaaccgttttggtgccaaatacggtaacgttgag
ttggttgacggtctcttacgtgatggtttatctgatgcatatgatggacttcccatgggt
aatgctgccgagctttgcgctgaggaacacagcattgaccgtgccagtcaagacgccttt
gccatttcttcttacaaacgtgctcaaaacgctcaagctacaaaggcatttgaacaagaa
atcgtccccgtcgaggtccctgttggtcgtggtaagcccaacaagcttgttactgaggac
gaggagcccaagaaccttaacgaagacaaactcaaatccgtacgtgctgtcttcaagagt
aacggtaccgtcactgctgctaatgcttctaccttgaacgatggtgctagcgctcttgtt
ctcatgtcggctgccaaagtgaaagaacttggtcttaagcctcttgctaaaattattggt
tggggtgaagccgctcaagatcctgagcgttttaccacttctccttcccttgctattccc
aaagctctcaagcatgcaggtattgaagcttcccaagttgactattacgagatcaatgaa
gcctttagtgttgttgctgttgccaacaccaaaattcttggattagatcccgagcgtgtt
aacattaacggaggtggtgttgccatgggtcatcccttgggtagcagtggttctcgtatc
atttgtactttggcatatattcttgctcagaaggatgccaagattggtgtagctgctgtt
tgcaatggtggtggtggtgcttcatccattgttatcgaaagagtttag

DBGET integrated database retrieval system