KEGG   Schizosaccharomyces pombe (fission yeast): SPBC216.02
Entry
SPBC216.02        CDS       T00076                                 

Gene name
mcp5
Definition
(RefSeq) dynein-anchoring factor Mcp5/Num1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Mcp5_PH PH PH_2
Other DBs
NCBI-GeneID: 2540712
NCBI-ProteinID: NP_595354
PomBase: SPBC216.02
UniProt: Q9Y7J9
Position
II:898075..900981
AA seq 968 aa
MEKKQDNEVELYSIDLKNRNESAKIKLAYAKALEESILCETRKIEQEIKDQVVQKENKTY
FNNKFDNRYKLRDLEKNLAEEEVRITEMLTIQRQDIAIERRKNTNCFSESSQVDQYSVTE
TNLQYATNIGLNLLQQLRYLRLQLSEKEDLHKKLSVDNAHLIKQLDLLSSNMKTLMKEKT
KVQGQRDLLEQRLQGLMKKLTEVESLTVSLNDEKNKLTLELTNLRICLHELQLNAEKGET
IDESEDSKNTLVTEDENDDSVFLESSSDKYFDSSSFDAEQEEKHDFPIDPFLSLESNVQT
SVSQSSAVLKSINLAKQELVSVNHLVADDTKTPSPNLSSEIIENTKADIKKSIRSLNKAV
SPENSIDIEDETDRDDEFICFLLSYQQLQKALKSNLGLFQLSCLYPLSLNHLIQSFFQSL
TSQISIKDIDSKNKQVIKLFKPTKSSDRQEIFELAQFEPRQKFPIDTNSSKCDMSASTEM
HLKDTEKFANFKLKENILNHSSIYERDVSYLPALNKGGRENYLNNRVSSYRLVKPILNSY
GNHVLNRIQHDILENHFCCLKNVKDFVCGANTISMQWNLQKNMEFISSVFSLIKNEVNDT
SANSVILRTDALSNVATTRLKRKLTSAIIDCSIPRRRLRHYSNPEIAEFKNFRLSTDISH
SNVRNSKKLCSNGSMNCMRQGKAVFPRKIPYQEHDWEQWEKIAQSSMFKNRSIASRQSLE
TSDVTLDINMSSRHSNGTSSMLFKDFTKHNNWEASTYPSAPKNTRTYPTAEVEKTRHDSS
QSARQLKARSTATTISISLSTVSDVFTLPRNNLKSKTNTKKCRDNLNLSGLSSSTCNANS
VNKLMKHVMMGNEMMKYPRSESFKMFKKSHWRYFWINPHCEMLCWSKTNPFIEKGRKNQV
KSVKIKGMTIIKAPDALKNANLHNEVIVMQTTDKPIVLKAKSKKIHNIWVQAIKQINHKA
IFDTKPGI
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggagaaaaaacaagataacgaggtggaattatattcaattgatttaaaaaatagaaat
gaaagtgcaaaaataaagcttgcttatgcgaaagcgttagaggaaagcattctttgtgaa
acacgaaaaatcgaacaagaaattaaagaccaagtggttcaaaaggaaaataaaacatat
tttaataacaaatttgataatcgatataaattacgcgacttggaaaaaaatttagcggag
gaggaggtgagaattacggagatgcttactattcaacgtcaagacattgcaattgaaaga
aggaagaacacaaattgcttcagtgagtcttctcaagtagatcaatattcagttactgaa
accaatctacaatatgctactaacattggcttaaaccttctgcaacagttgcggtattta
aggctgcaactgtcagagaaagaagatttgcataaaaagttgtcagtggataatgcccat
ttaatcaagcaacttgatctactttcttcaaacatgaaaacacttatgaaagagaagact
aaggtgcaaggacaaagggatttgcttgaacaaagactacaaggattaatgaaaaaattg
acagaagtagagtctttgaccgtttcacttaacgatgagaagaacaaactgacattggaa
ttaacaaatttaagaatttgccttcacgagcttcaactgaatgccgaaaaaggcgaaact
atagatgaaagtgaagattctaaaaatactttggtaactgaggatgaaaacgacgattct
gtatttttggagtcttcctcggataagtattttgatagttcatcttttgatgcggagcaa
gaagagaaacacgattttccaatagatccttttttgtcgttggaatccaatgtacaaact
tcggtatctcaatcatcggccgttctcaaatccatcaatttagcaaaacaggagttagtg
agtgtaaatcatttggtagctgacgatactaaaacaccgtctccaaatttatcatcggaa
ataattgaaaacacaaaagctgacataaagaaatcaatcaggtctctgaacaaggcagta
tcaccagaaaactctatagacatcgaagatgaaaccgacagagatgatgagtttatttgc
ttccttttgtcttatcagcaactacaaaaggcgctgaaaagtaacttgggcctttttcag
ctttcttgcttgtacccactttctctgaatcatcttattcagtcattctttcaatctctc
acctctcaaatttcaataaaagatattgactcaaaaaataaacaagtcattaaacttttc
aaaccgactaaaagctcagatcgccaggaaatttttgaattggctcaatttgaacctcgc
caaaaatttcctatagatacgaattcttcaaaatgcgacatgtctgcaagtactgagatg
catttgaaagatactgaaaaatttgctaatttcaaactaaaagaaaacattttaaatcat
tcttctatttacgaacgtgatgtttcttacctgcctgcattaaacaaaggtggacgtgaa
aattatttaaacaatcgcgtctcctcttataggcttgttaaacctattttaaattcctat
ggaaatcatgtattaaaccgtatacaacatgatattctggagaatcacttctgttgtcta
aaaaatgtcaaagactttgtatgtggtgcaaatacaatctccatgcagtggaatctgcaa
aagaatatggaatttatcagctctgttttttccttaataaaaaatgaagtaaatgacaca
tcagctaatagtgtcattctaaggaccgatgcgctttcaaatgttgctaccacgaggttg
aaaagaaaattaactagcgctattattgactgctcgattcctcgtcggaggttgcgccac
tatagtaatccagaaatagctgaatttaagaattttagattatctacggatatttcccac
agtaatgttaggaattcgaaaaagctatgttccaatggatctatgaattgtatgaggcaa
ggcaaggcagtttttcctcgaaagatcccatatcaagagcatgactgggaacaatgggaa
aaaattgctcaatcctcgatgtttaagaatcgttcaattgcttcacgtcaatcattggaa
acttctgatgttactttggacattaatatgtcttcaagacattcaaacggaacttcctca
atgcttttcaaagactttacaaaacataataattgggaggcgtcaacttatccgtctgca
cctaagaatactcgtacttatccaacagctgaagttgaaaaaactcggcatgattcctcg
caatcagcacgtcaattgaaagcaagaagtacggctacgacgatttctatttccttgtcg
acggtgtcagacgtattcaccttacctcgcaataatctcaaaagcaaaacaaatacgaaa
aaatgcagagataatttgaatctatcaggtttatcttcttcaacttgtaatgcaaattct
gtgaacaaattgatgaaacatgtcatgatgggaaacgaaatgatgaagtacccgagaagt
gagagtttcaaaatgtttaaaaagagtcattggcgctatttttggattaacccgcattgt
gaaatgctgtgctggtctaaaacaaatccatttattgaaaaaggaaggaaaaatcaagtc
aagtctgtgaaaattaagggaatgactattataaaagccccagatgccttaaagaacgcc
aatttacataatgaagttattgtgatgcagacaactgataagcccatcgtcttaaaagcg
aaaagcaagaaaattcacaatatctgggttcaagctatcaaacaaataaatcataaggct
atctttgatactaagcccggcatttaa

DBGET integrated database retrieval system