KEGG   Schizosaccharomyces pombe (fission yeast): SPBC21C3.07c
Entry
SPBC21C3.07c      CDS       T00076                                 

Definition
(RefSeq) tRNA (cytosine) methyltransferase
  KO
K17053  tRNAThr (cytosine32-N3)-methyltransferase [EC:2.1.1.268]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPBC21C3.07c
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.268  tRNAThr (cytosine32-N3)-methyltransferase
     SPBC21C3.07c
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    SPBC21C3.07c
SSDB
Motif
Pfam: Methyltransf_12 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Ubie_methyltran NNMT_PNMT_TEMT Methyltransf_8 MTS Methyltransf_24 CMAS TPMT Rsm22 Roc Ras
Other DBs
NCBI-GeneID: 2540321
NCBI-ProteinID: NP_596587
PomBase: SPBC21C3.07c
UniProt: Q9P7L6
Position
II:complement(join(3807714..3807783,3807831..3807891,3807946..3808607,3808665..3808795))
AA seq 307 aa
MDTTPDNSEKKKTSSVREATFSINESFGGRLLTEEEDVFEQNAWDHVEWDDEHLALAKKC
IEEQKLYPVTEKDAYMTHPERYWDQFYGKNEGKFFMNRRWIAQEFPELLDLLKEDAGEKS
ILEIGCGAGNTIWPILKENKNSNLKIFAVDYSEKAIDVVKQNPLYDAKFCSASVWDLAGS
DLLRSIEEASIDAITLIFCFSALSPDQWQQAIENLYRLLKPGGLILFRDYGRLDLTQLRA
KKNRILSENFYIRGDGTRVYYMTNEELVDVFGKNFKIIQNGVDKRLIVNRKKRVKMYRCW
LQAKFQK
NT seq 924 nt   +upstreamnt  +downstreamnt
atggatacaacaccagataattctgagaagaaaaaaacttcttctgtaagagaagcaact
ttttcaattaatgaatcatttgggggtcgtctgctcacagaagaagaagatgttttcgag
caaaatgcgtgggatcatgtagaatgggatgatgagcatttagcattggccaaaaaatgt
atagaggaacaaaaactatatcctgtaaccgaaaaggatgcttatatgacacatcctgaa
aggtactgggaccaattttatggaaaaaacgaaggaaaatttttcatgaatagaagatgg
attgcgcaagagttcccagagcttcttgacttgctaaaagaagatgcaggagaaaaatca
attttagaaattggatgcggtgctggaaacactatctggccaattttgaaggaaaacaaa
aactcaaatcttaaaatatttgctgttgattattcagaaaaggccattgatgttgttaaa
cagaacccattatacgatgccaagttttgcagtgcttcggtttgggatctggcaggatca
gacttactaagatccattgaagaagcgtctattgatgcgattacactcattttctgtttt
tcagcattgtcccccgatcaatggcaacaagctatagaaaacttgtatcgattattaaag
cctggaggattaattttatttcgtgactatggtcgtttagatttgacgcagctaagagct
aaaaagaacagaattttaagtgaaaatttttacataagaggtgatggtacaagagtgtat
tacatgacaaacgaagaactagtggatgtttttggaaaaaatttcaaaattattcaaaat
ggagttgacaaaaggcttattgtaaaccgaaaaaaaagagtcaagatgtaccgttgctgg
ctacaagccaagtttcaaaaatga

DBGET integrated database retrieval system