KEGG   Schizosaccharomyces pombe (fission yeast): SPBC21D10.10
Entry
SPBC21D10.10      CDS       T00076                                 

Gene name
bdc1
Definition
(RefSeq) bromodomain-containing protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Bromodomain Herpes_UL6 LemA DIT1_PvcA AAA_13 MIC19_MIC25 DUF3810 FAD-SLDH
Other DBs
NCBI-GeneID: 2540686
NCBI-ProteinID: NP_596003
PomBase: SPBC21D10.10
UniProt: O74350
Position
II:complement(2424574..2425473)
AA seq 299 aa
MNIAQEVAVLQYLDIQQENPNAPNEELFNRTAESSLLLEPIEQDQLKDLVEEWMHDSNKS
DSKLLSNQVSQNDNDARKNLRKRLRNDVLKDLAEEIQGCEKKLESLYEEVAKAKAKAVED
QLALEEADKEAKKAKTEAPVEAANKSLRSRKKTPEIAAPANIEPEVAPTTKTPKKRAALS
NEEKQSLKKFQSAMLPMLDNISNHRFGAPFSHPVNRKEAPDYDSLVYKPQDLRTLKNMIK
EGNITEVDELYREVLRIFANCKMYNGSDPANAMSIWGDECFRYTEELFDIYRQASTRSQ
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaatattgctcaagaggttgctgttttacaatatcttgatattcagcaagaaaatcct
aatgctcccaacgaagaactcttcaatcgaacggcagaaagcagcctgcttttagagcca
attgaacaagatcaattaaaggatctggtcgaggaatggatgcatgatagcaataaatct
gattcaaagcttctctccaaccaagtttctcaaaacgataatgatgctcgaaaaaatcta
cgaaaaaggctgcggaacgatgtcctaaaggatttggctgaagagatacagggatgtgaa
aaaaaactggaaagcttatatgaagaggttgcaaaggcaaaggcaaaagctgtggaggat
caactcgcacttgaagaagctgacaaggaagcaaaaaaagcgaaaactgaagctcctgta
gaggctgctaataaatctcttcgttctagaaagaaaacaccagagattgcagctcctgca
aatatcgaacccgaagttgcacccacaactaagactccaaaaaagcgcgctgccctgtct
aatgaagaaaagcagtctttgaaaaagttccaaagtgcaatgcttcctatgctcgacaat
atttctaatcacaggtttggagcaccttttagtcatcctgtaaatcgtaaagaggcacca
gattacgattctttagtttataaacctcaagacttacgaacattgaagaatatgatcaaa
gagggtaacatcacggaagtggatgaattgtatcgagaagttcttcgaatctttgctaat
tgtaaaatgtacaatggcagcgatccagccaacgccatgtccatatggggagatgaatgt
tttcgctacacagaagagcttttcgatatttatcgtcaggcaagtacccgttctcaatga

DBGET integrated database retrieval system