KEGG   Schizosaccharomyces pombe (fission yeast): SPBC21H7.04Help
Entry
SPBC21H7.04       CDS       T00076                                 

Gene name
dbp7
Definition
(RefSeq) putative ATP-dependent RNA helicase Dbp7
  KO
K14806  ATP-dependent RNA helicase DDX31/DBP7 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPBC21H7.04 (dbp7)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC21H7.04 (dbp7)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPBC21H7.04 (dbp7)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC21H7.04 (dbp7)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    SPBC21H7.04 (dbp7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII CMS1
Motif
Other DBs
NCBI-GeneID: 2540518
NCBI-ProteinID: NP_595929
PomBase: SPBC21H7.04
UniProt: O60173
Position
II:2258814..2260943
Genome map
AA seq 709 aa AA seqDB search
MADEPLLLNFVVDNAQSRKPEALKSSRRWTDRARDRKRQKRNSNESSKSTVKRNSGTNGA
STDYKNSQKEKVINPVFDPRKPAHELKGNKRDNTFVTSLFTGDDSEHFSQDVGQNLEDNQ
ISNIGTTKEASNAPIKTTNFAGVQLDTQLADHLNNKMNISAPTAIQSCCLPALLNTDDKD
AFIEAQTGSGKTLAYLLPIVQRLIRLPKNLHTRTSGIYAVIMAPTRELCQQIYNVANKLN
NNPLSHWIVSCNVIGGEKKKSEKARIRKGVNILIGTPGRLADHLENTEALDVSQVRWVVL
DEGDRLMDMGFEETLTKILSYLESQSSIIKKDLSIPSRKVTMLCSATMKDTVKRLSDSAL
KDALYLKSSIVEETNDGYSQAPEQLLQRYVVVPPKLRLVSLVALLRSHVRSYKKIIIFLS
CSDSVDFHFEAFRCAINADEMEEAVKEKPDSEGDIISNAPALRIDGKSNVYRLHGSLSQQ
IRTSTLNLFSSSEDSGSHILLCTDVAARGLDLPNVDLVVQYDAPFSTDDYLHRIGRTARA
GHNGAAIMFLLPKESEYINLLKSSVSANILEQPNGPSGLLSAGFSQGKTNTNDWQDRATE
WQLELERFILENEPMRNIAKRAFTSYVRAYATHLSSERSIFNMRDLHLGHIAKSFALREA
PGKISGANSSKPRKQGGSVDKGKSKSSKDIAALMHRKAMEHYSTEHNIG
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaaccattgcttctcaattttgttgttgataatgctcaatcaagaaagcct
gaagccttgaagtctagtcgtcgctggactgatcgcgctagagatagaaaaaggcaaaaa
cgcaattctaatgaatcatcaaaatcaaccgttaaaagaaattcaggcacaaatggtgct
tccactgattataaaaattcacaaaaggaaaaagtaataaatcctgtgtttgatcctaga
aaaccagctcatgagctaaaaggcaacaagcgcgataatacttttgttacatctttgttt
acgggtgatgattctgagcatttttcacaggacgttggtcaaaatcttgaggataatcaa
attagtaatattgggactacaaaggaggcatccaacgcacctattaaaactaccaacttt
gctggtgttcaattagatactcaactggctgatcatttaaataataaaatgaacattagc
gctcccactgctatccaaagctgttgtcttccagcattgctaaacacagatgataaggat
gcgttcattgaagcacaaaccggatcgggtaaaactttggcttatttactaccaattgtg
caacgattgattcgacttcctaaaaacttacacacccgtactagcggtatatatgctgtg
attatggctccaacccgggagttatgccaacaaatttataacgttgctaacaagctcaac
aataatccgttatcacactggattgtctcctgtaatgtgataggtggtgagaagaaaaaa
agtgaaaaggctcgcatacgaaagggtgttaatattttaattggaacgcctggtcgtttg
gcggatcatttagaaaatacggaagcactggatgttagtcaagtacgatgggtcgttttg
gatgaaggtgataggttgatggatatggggtttgaagaaactttgactaaaattttatct
tatttggaatcacaaagcagtattattaagaaggatctcagtattccttctcgtaaggtt
acaatgctttgctccgctacaatgaaagataccgtaaagcgtttaagtgattccgcttta
aaagatgctttgtacttaaaatcatctattgtggaggaaaccaatgacggttatagccag
gcacccgagcagcttcttcaaagatatgttgttgttcctccaaaactgaggcttgtaagc
ttggttgccctattgcgaagtcatgttagatcatataagaaaataataatttttctttct
tgttcagatagtgttgattttcactttgaagcttttagatgtgcgataaacgctgatgaa
atggaagaggccgtgaaagagaaaccggactctgagggtgatatcatttcaaatgctcca
gctctgagaatagatggcaaatcaaatgtataccgattacacggttccttgtctcaacaa
atcaggacttcgacgctgaatcttttttcttcaagtgaagattctggttcacatatactt
ttgtgtacagatgtggcagcccgtggtcttgatctgccaaatgttgatttggttgtgcag
tatgatgctccgtttagtaccgacgattatttgcatagaattggcagaacagctagggct
ggacacaatggtgcagctattatgtttttactcccgaaggaaagtgaatatattaatttg
ttaaagtcttcagttagcgctaatatattggagcagcctaatggtccatctgggttgttg
agtgctggtttttcgcaaggtaaaacaaacaccaatgattggcaagatcgtgcaacagaa
tggcagttggaattggagcgttttatattagaaaatgaacctatgaggaatattgcaaaa
agggcttttacttcttatgtgagggcttatgcaacacatctttcatcagaaagaagtatt
tttaacatgcgtgaccttcatttgggacatattgctaagtccttcgctttgcgagaagcg
ccgggcaaaatatctggtgcaaattcttcaaagccaagaaagcagggtggttcggttgat
aaaggtaaaagtaaatcatcgaaagacattgctgctttgatgcacagaaaagcaatggaa
cattattcaacggaacacaatataggataa

DBGET integrated database retrieval system