KEGG   Schizosaccharomyces pombe (fission yeast): SPBC21H7.07c
Entry
SPBC21H7.07c      CDS       T00076                                 

Gene name
his5
Definition
(RefSeq) imidazoleglycerol-phosphate dehydratase His5
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00340  Histidine metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SPBC21H7.07c (his5)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     SPBC21H7.07c (his5)
SSDB
Motif
Pfam: IGPD
Other DBs
NCBI-GeneID: 2540675
NCBI-ProteinID: NP_595932
PomBase: SPBC21H7.07c
UniProt: P40374
Position
II:complement(2266666..2267316)
AA seq 216 aa
MRRAFVERNTNETKISVAIALDKAPLPEESNFIDELITSKHANQKGEQVIQVDTGIGFLD
HMYHALAKHAGWSLRLYSRGDLIIDDHHTAEDTAIALGIAFKQAMGNFAGVKRFGHAYCP
LDEALSRSVVDLSGRPYAVIDLGLKREKVGELSCEMIPHLLYSFSVAAGITLHVTCLYGS
NDHHRAESAFKSLAVAMRAATSLTGSSEVPSTKGVL
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaggagggcttttgtagaaagaaatacgaacgaaacgaaaatcagcgttgccatcgct
ttggacaaagctcccttacctgaagagtcgaattttattgatgaacttataacttccaag
catgcaaaccaaaagggagaacaagtaatccaagtagacacgggaattggattcttggat
cacatgtatcatgcactggctaaacatgcaggctggagcttacgactttactcaagaggt
gatttaatcatcgatgatcatcacactgcagaagatactgctattgcacttggtattgca
ttcaagcaggctatgggtaactttgccggcgttaaaagatttggacatgcttattgtcca
cttgacgaagctctttctagaagcgtagttgacttgtcgggacggccctatgctgttatc
gatttgggattaaagcgtgaaaaggttggggaattgtcctgtgaaatgatccctcactta
ctatattccttttcggtagcagctggaattactttgcatgttacctgcttatatggtagt
aatgaccatcatcgtgctgaaagcgcttttaaatctctggctgttgccatgcgcgcggct
actagtcttactggaagttctgaagtcccaagcacgaagggagtgttgtaa

DBGET integrated database retrieval system