KEGG   Schizosaccharomyces pombe (fission yeast): SPBC23E6.07c
Entry
SPBC23E6.07c      CDS       T00076                                 
Symbol
rfc1
Name
(RefSeq) DNA replication factor C complex subunit Rfc1
  KO
K10754  replication factor C subunit 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC23E6.07c (rfc1)
   03420 Nucleotide excision repair
    SPBC23E6.07c (rfc1)
   03430 Mismatch repair
    SPBC23E6.07c (rfc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC23E6.07c (rfc1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC23E6.07c (rfc1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    SPBC23E6.07c (rfc1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     SPBC23E6.07c (rfc1)
SSDB
Motif
Pfam: RFC1 BRCT AAA Rad17 AAA_22 RuvB_N Sigma54_activat AAA_33 SAGA-Tad1 AAA_18 AAA_14 AAA_16 AAA_5 DNA_pol3_delta AAA_30 AAA_28 NTPase_1 DUF2140 AAA_17
Other DBs
NCBI-GeneID: 2540426
NCBI-ProteinID: NP_596607
PomBase: SPBC23E6.07c
UniProt: O60182
Position
II:complement(3852657..3856111)
AA seq 934 aa
MSNSDIRSFFGGGNAQKKPKVSPTPTSPKPKRSLKKKRIVLSDDEDGTIENSKVPASKSK
VQKRNESEDISHSLPSIVHEDDKLVGSDGVSTTPDEYFEQQSTRSRSKPRIISNKETTTS
KDVVHPVKTENFANDLDTTSDSKPVVHQTRATRKPAQPKAEKSTTSKSKSHTTTATTHTS
RSSKSKGLPRFSDEVSQALKNVPLIDVDSMGVMAPGTFYERAATTQTPGSKPVPEGNSDC
LSGISFVITGILETLTRQEATDLIKQYGGKVTGAPSVRTDFILLGENAGPRKVETIKQHK
IPAINEDGLFYLITHLPASGGTGAAAQAAQQKKEQEEKKILETVARMDDSNKKESQPSQI
WTSKYAPTSLKDICGNKGVVQKLQKWLQDYHKNRKSNFNKPGPDGLGLYKAVLLSGPPGI
GKTTAAHLVAKLEGYDVLELNASDTRSKRLLDEQLFGVTDSQSLAGYFGTKANPVDMAKS
RLVLIMDEIDGMSSGDRGGVGQLNMIIKKSMIPIICICNDRAHPKLRPLDRTTFDLRFRR
PDANSMRSRIMSIAYREGLKLSPQAVDQLVQGTQSDMRQIINLLSTYKLSCSEMTPQNSQ
AVIKNSEKHIVMKPWDICSRYLHGGMFHPSSKSTINDKLELYFNDHEFSYLMVQENYLNT
TPDRIRQEPPKMSHLKHLELISSAANSFSDSDLVDSMIHGPQQHWSLMPTHALMSCVRPA
SFVAGSGSRQIRFTNWLGNNSKTNKLYRMLREIQVHMRLKVSANKLDLRQHYIPILYESL
PVKLSTGHSDVVPEIIELMDEYYLNREDFDSITELVLPADAGEKLMKTIPTAAKSAFTRK
YNSSSHPIAFFGSSDVLPMKGSAQREVPDVEDAIEAEDEMLEEASDSEAANEEDIDLSKD
KFISVPKKPKKRTKAKAEASSSSSTSRRSRKKTA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgagtaattctgacattcgaagcttctttggaggagggaacgctcaaaaaaagccaaaa
gtctcaccgactcctacttccccaaaaccaaaaaggagtttgaagaaaaaaagaatcgtt
ttatcagatgatgaagatggtacaatagagaattcaaaagttcctgcatccaaaagcaaa
gtgcaaaaacgtaatgagtcggaagatatttcccattctttgccatccattgttcatgaa
gacgataaacttgtcggttcagatggagtttcaactacacctgatgagtactttgaacaa
cagtctactcggtcacgttctaaaccgcggattatctccaataaagaaactactacttcc
aaagatgtcgtacatcctgtaaaaacagaaaattttgccaatgacttggataccacttca
gacagtaagccagttgtccatcaaactagagctacacgtaaacctgctcaacctaaagca
gaaaaatcgacaacttcaaagtcaaaatctcataccacaactgcgacaactcacacaagt
cgttctagcaagtcgaaaggcttacctaggttctcagacgaagtttcccaagccctcaaa
aatgttcctttaattgacgtagactctatgggtgtgatggctccaggtactttctatgaa
cgggcggctacaacacaaactccaggctcaaaacccgtccctgaaggcaatagcgattgt
ctctcgggaattagctttgttattacaggaattctagagactttaactagacaagaggct
acagacctgatcaaacaatatggtggaaaagtgacaggtgcaccttctgttagaacagac
tttattctcttaggtgagaatgctggtccaagaaaagtggaaacaattaaacaacacaag
attcctgctattaacgaggatggactcttctatcttataactcatcttcctgcttcagga
ggaacgggtgctgcggctcaggctgctcaacagaaaaaggaacaagaagaaaagaaaatc
cttgaaactgttgcgagaatggacgatagtaataaaaaggaatcacaaccttcacagata
tggacttcaaaatatgcgccaacttctttaaaggatatttgtggtaataagggtgtcgtt
caaaaacttcaaaagtggctacaggattaccacaaaaacaggaagtccaactttaataaa
cctggacctgatggtctgggtctatacaaagccgtattactctctggtcctccaggtatt
ggcaagacgactgctgctcatttggtagcaaaattagaaggttacgatgttttggaactg
aacgctagtgacactagaagcaagcgcttgctagatgagcagctgttcggtgtgacagat
agtcaatcacttgccggctactttggcacaaaagctaaccccgttgacatggcaaagtcc
cgacttgtactcattatggacgaaatcgatggcatgtcatcgggtgatcgtggaggcgtt
ggtcagttgaatatgattattaaaaaaagcatgataccaattatttgtatttgcaatgac
cgtgctcatccaaagctgcggccccttgaccgtactacgtttgacctccgtttccgtcgg
ccagatgctaattcaatgcgatcccgaataatgtctatagcgtatcgtgaaggtctcaaa
ttgtcaccacaagcagtcgatcaactggttcaggggacgcagtccgatatgcgccaaatt
attaatttgctatccacttacaagttaagctgttcagaaatgacacctcaaaatagccaa
gctgttattaaaaattctgaaaagcatatcgttatgaaaccatgggatatctgtagtcgt
tacttacatggaggaatgtttcatccatcaagcaagtccaccattaatgataaattagag
ctgtattttaatgatcacgaattttcttatcttatggttcaagaaaactaccttaatact
acaccagatagaattcgtcaagaaccaccgaaaatgtcacatttgaagcatttagaatta
atatctagtgctgctaactccttttccgactctgatcttgttgattcaatgattcatggt
cctcaacaacactggtcacttatgccaacccatgctcttatgtcttgcgtgcgacctgct
tctttcgtggctggttccggttccaggcagattcgctttactaattggttgggtaataac
tcgaagacaaataaattatatcgtatgcttcgtgagatacaagtacacatgcgtttaaaa
gtatccgctaataaattggacttgcggcagcattatattccaatattgtatgagtctctg
cctgtaaagctatcaacaggccattcagacgtcgttccagaaatcattgaattgatggat
gaatattatctaaatcgtgaagattttgattcaataacggaattagttcttcctgcagat
gcaggtgagaaactcatgaaaaccataccgactgctgcaaaatctgcattcacaagaaaa
tacaattcttcgagtcaccccatcgccttctttggaagtagtgatgttttacctatgaag
ggctctgctcagcgcgaagtgccggatgtcgaagatgcaattgaagccgaagatgagatg
ttagaagaagctagtgactcagaggctgctaatgaagaggacatagatttaagcaaagac
aaatttatttcggtaccaaagaaacctaaaaaaaggactaaggcaaaggctgaagcgtcc
tcttctagctcaaccagtcgccgatccagaaaaaagacagcttaa

DBGET integrated database retrieval system