KEGG   Schizosaccharomyces pombe (fission yeast): SPBC24C6.10c
Entry
SPBC24C6.10c      CDS       T00076                                 

Gene name
dip1
Definition
(RefSeq) WISH/DIP/SPIN90 ortholog Dip1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF2013
Other DBs
NCBI-GeneID: 2540504
NCBI-ProteinID: NP_001342760
PomBase: SPBC24C6.10c
Position
II:complement(join(2341811..2342790,2342911..2343000,2343096..2343150))
AA seq 374 aa
MEFTDVFYNLENEKQFLAEIDELLTIPYEKNELEIGVSKFLSFINKYGEPYLITEFQLQR
CMEKFLNSPLYQLDENAVLSIFYDCFFFLKEQQTLKFIIIVFQSEIQENEYCLRLLASTG
FIPVLIKAMKQFKDRSENVAFTSFRYALFLVYYICRSRRLSPTDLVAIDEYFLVNLFKTS
EEAWNDEDMDSFGMCVLTLLSINEQFMLVRLASKGSFEIANGIMDLLSSSKVDNGIYSEG
LVFTLNREKDPRSRMLILKQLFLLFTTPATYEIFYTNDLNVLIDIFIREINNIPDELSDL
RYAYLQVLIPLLENTQVRHPPHYKTKCIVDAVNNVLISHSKSSNMEDARTTDVAIRVLEV
PWLQQEMKSLGTAQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggagttcacggatgtgttttataatttagagaatgaaaagcaatttttggcggaaatt
gacgaacttttaactataccatacgaaaaaaatgaactggaaattggtgtttcaaagttt
ctttcttttatcaacaaatatggagaaccgtacctaattacagaattccaattgcagaga
tgtatggaaaagttcctcaatagtccgctttatcaactagacgaaaacgccgttttaagt
attttctatgattgcttttttttcttgaaagaacaacaaactttgaaattcataatcatt
gtctttcaatccgaaattcaagagaatgagtactgcttgcgtttgttggcttctacgggg
ttcattcccgtcttgatcaaggcaatgaaacagttcaaggatcgttcagaaaatgttgct
tttacatcttttcgttatgctttattcttagtgtactatatttgtcgctcgagacgactt
tcaccgaccgacttagtcgcaattgatgaatattttttagtaaacctattcaaaacgtcg
gaagaagcttggaatgatgaggacatggacagttttggaatgtgcgtcttgacattgctt
agcatcaatgaacagtttatgcttgttcggcttgcttccaaaggttcgtttgaaatcgca
aatggcataatggatttgctgagctcttccaaagtggataacggtatctacagtgaaggc
ctagttttcactctaaatcgagaaaaggatccacgctctcgaatgttaatactaaaacaa
ctattccttctttttacaactcccgctacgtatgagatattctataccaatgatctcaat
gtcctaattgatatattcatacgcgaaataaacaatattcccgatgagctttcggatctt
cggtatgcatatttgcaagttttgattcctttgcttgaaaatacacaggtgcgccatcca
cctcattacaaaactaagtgtatagtcgacgcggtcaataatgtcttaatttctcactca
aaaagcagcaacatggaagatgcacgtactacagatgttgccatacgtgttttagaagta
ccgtggcttcaacaagagatgaagtcattaggaaccgctcaataa

DBGET integrated database retrieval system