KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25D12.03cHelp
Entry
SPBC25D12.03c     CDS       T00076                                 

Gene name
mcm7
Definition
(RefSeq) MCM complex subunit Mcm7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo04111  Cell cycle - yeast
spo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC25D12.03c (mcm7)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPBC25D12.03c (mcm7)
   04113 Meiosis - yeast
    SPBC25D12.03c (mcm7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPBC25D12.03c (mcm7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC25D12.03c (mcm7)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPBC25D12.03c (mcm7)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPBC25D12.03c (mcm7)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    SPBC25D12.03c (mcm7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCM MCM_OB MCM_N MCM_lid Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 2540630
NCBI-ProteinID: NP_596545
PomBase: SPBC25D12.03c
UniProt: O75001
Position
II:complement(3717638..3719920)
Genome map
AA seq 760 aa AA seqDB search
MALPTIDLKIPEYEECQHKITDFLSHFKQEQVQDGQQNQDISMSDAGDEPFLKSKYMDIL
QKISNRESNVINVDLNDLYEFDPSDTQLLHNIESNAKRFVELFSQCADALMPPPTVEINY
RNEVLDVIMQQRVQRNENIDPEHKGFPPELTRGYDLYFRPVTRNKKPFSVRDLRGENLGS
LLTVRGIVTRTSDVKPSLTVNAYTCDRCGYEVFQEIRQKTFLPMSECPSDECKKNDAKGQ
LFMSTRASKFLPFQEVKIQELTNQVPIGHIPRSLTVHLYGAITRSVNPGDIVDISGIFLP
TPYTGFRAMRAGLLTDTYLECHYVSQIIKNYTNIEKTPQSEAAIAELNQGGNVYEKLAKS
IAPEIYGHEDVKKALLLLLVGGVTKELGDGMRIRGDINICLTGDPGVAKSQLLKYISKVA
PRGVYTTGRGSSGVGLTAAVMRDPVTDEMVLEGGALVLADNGICCIDEFDKMDESDRTAI
HEVMEQQTISISKAGITTTLNARTSILAAANPLYGRYNPKVAPIHNINLPAALLSRFDIL
FLILDTPSRETDEHLAQHVTYVHMHNEQPKMDFEPLDPNMIRHYISSARQYRPVVPKDVC
DYVTGAYVQLRQNQKRDEANERQFAHTTPRTLLAILRMGQALARLRFSNRVEIGDVDEAL
RLMSVSKSSLYDDLDPSSHDTTITSKIYKIIRDMLNSIPDVEGNERSLTLRAIRERVLAK
GFTEDHLINTIQEYTDLGVLLTTNNGQTIMFLDPDLHMEN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcccaccatagatttaaaaatcccagagtatgaagaatgtcaacataaaatt
acggattttctatcccacttcaagcaggaacaggttcaagatggacaacaaaatcaggat
atttcgatgtcggatgcaggtgatgagccttttttaaaatcaaagtatatggatatacta
caaaaaatctccaatcgagagtcaaatgttattaatgttgatttgaatgatttgtacgag
ttcgatccaagtgatactcagcttttgcataatattgaatctaatgctaaacggtttgtt
gaacttttttcgcagtgcgcagatgcgttgatgcctcctcctactgtggaaattaattat
cgcaacgaagtacttgatgtaattatgcagcaacgtgttcaaaggaatgaaaatatagac
cctgagcataaaggatttcctcctgaattaacccgaggttatgacttatactttcgacca
gtaactcgcaacaaaaaaccattcagcgttcgtgatttaagaggcgaaaacttgggatct
cttttgactgtccgtggtatagttactcgtacaagtgatgttaagcctagcttaactgta
aatgcttatacatgtgatcgatgtgggtatgaagtgtttcaagaaatccgtcagaagaca
ttccttccaatgtctgaatgtccttcggatgaatgtaaaaagaatgatgcaaaaggtcag
cttttcatgagcacaagagccagtaaatttcttccttttcaggaagtaaaaatacaagaa
ttaacgaaccaagtacctattggccatatccctagatcattaaccgtccacttatatggt
gctatcactcgctctgtaaatcctggcgatatcgttgatatttctggtatatttttgccg
actccgtatactggttttcgagcaatgcgcgccgggctcttaaccgatacttacttagaa
tgccattatgtttcacaaatcattaaaaattacacaaatattgaaaaaactcctcaatcg
gaggctgctatcgctgaattaaatcaaggaggcaatgtgtacgaaaaactggccaagtcc
attgctcccgagatatatggacatgaagatgttaaaaaagctttacttctgttgcttgtc
ggaggtgttactaaagagttaggggatggaatgagaattcgtggtgacataaatatttgt
ttaactggtgatcctggtgtcgcaaaatctcaattattaaagtatatttcgaaggttgcc
ccgagaggagtatacaccacaggtcgtggatcttcaggtgttggtttaactgctgctgta
atgcgtgatccagtgacggatgaaatggttttagagggaggtgccttagtacttgctgac
aacggtatttgctgcattgacgaatttgataagatggatgaaagtgaccgtacagcaatt
catgaagtaatggaacagcaaactatttcaatttcaaaggcaggaatcactacgacttta
aatgctcgaacaagtattttggccgctgcgaaccccttatatggacgatataatccgaaa
gtggcaccaatccacaatataaatcttccagctgcactgctttcccggtttgatatttta
tttttaattttagatactccttctcgtgaaacagacgagcatttggcacaacacgtaaca
tatgttcacatgcataacgaacaacctaaaatggactttgaaccattagatccaaacatg
attaggcattatatttcttctgctagacaatatcgcccagtcgtaccaaaggatgtatgc
gactatgttactggtgcttatgttcaacttcgacaaaaccaaaagcgtgatgaagccaat
gagcgtcaattcgctcacactactccacgtacacttctcgctattttgcgaatgggacaa
gcattagctcgtttgcgtttcagtaatagagtggagattggcgatgttgatgaagctttg
agattaatgtctgtttcaaagtcatcactatacgatgatttggatcctagttctcacgat
actactattacctcgaaaatatataaaattattcgagacatgcttaatagcataccagat
gttgaaggcaatgaacgctcacttacactacgtgctattcgtgaacgcgtacttgctaag
ggttttactgaagatcatttaataaatacaatacaggaatatacagaccttggtgttctt
ttaactacaaacaatggtcaaacaataatgttcctcgatccggatttacatatggagaat
taa

DBGET integrated database retrieval system