KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25H2.06c
Entry
SPBC25H2.06c      CDS       T00076                                 

Gene name
hrf1
Definition
(RefSeq) putative COPII-coated vesicle-associated protein Hrf1
  KO
K20362  protein transport protein YIF1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC25H2.06c (hrf1)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    SPBC25H2.06c (hrf1)
SSDB
Motif
Pfam: YIF1
Other DBs
NCBI-GeneID: 2540356
NCBI-ProteinID: NP_596360
PomBase: SPBC25H2.06c
UniProt: P87148
Position
II:3272930..3273811
AA seq 293 aa
MPPKLYHPQPTHAIPVSNMRVNTRYEPTAGFSGTSVPSVQAANPSAYLPNSATAQMGFQL
GKNAVNAGQEYVEQNFGKWLSTTRLHHYFTVTNSYVVAKLLLIIFPWRRRSWARKLRRSE
INGSAEGYCPPAEDLNSPDMYIPLMAFTTHILLLCALAGLQDDFQPELFGLRASKACAVV
LVEFLATRLGCYLLNISSQSQVLDLLAFSGYKFVGLILTSLSKLFEMPWVTRFVFLYMYL
ATAFFLLRSLKYAVLPESTMAINATITSHQRSRRIYFLFFIAASQILFMYVLS
NT seq 882 nt   +upstreamnt  +downstreamnt
atgccacccaagttgtaccatcctcaacccacacatgccattcctgtttccaatatgcgc
gtaaatacacgttatgaacccaccgctgggttttctggaacctccgtaccgtccgttcaa
gcagctaatccatcagcatacttacccaattcagccactgctcaaatgggatttcagtta
ggtaaaaatgcagtcaacgcaggccaagaatatgttgaacaaaattttggaaaatggctt
tctaccacaagacttcaccactatttcacagtcactaattcctacgttgtggccaagctt
ttgctcatcatctttccatggcgccgtaggtcatgggctagaaagttaaggcgctctgaa
attaacgggagtgctgaaggttattgccctcctgcggaagacttaaattctcctgatatg
tacattccgttaatggcgttcaccactcatattcttttgctgtgtgctttggctggattg
caagatgatttccaacccgagctatttggccttcgtgctagtaaggcttgtgctgtcgta
ttggtggaattcctagcgacgcgtttaggttgttatttattaaatatttctagccaaagt
caggttctcgatttattggccttcagtggatataaatttgttgggcttattcttacttca
ctcagtaagctgtttgaaatgccatgggtcacaagatttgttttcttatacatgtacctt
gctaccgcattttttctcttgcgttcacttaaatacgctgttcttccagagtcgactatg
gctattaacgcgactattacctctcaccagaggagtcgtcgtatctactttctatttttt
atcgctgcatctcaaattctattcatgtatgtgctgtcttaa

DBGET integrated database retrieval system